Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.36
PubTator Score 3.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 3.4e-06
breast carcinoma 1614 4.4e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.885 3.4e-06
breast carcinoma 1.200 4.4e-02

Gene RIF (4)

PMID Text
22203677 Detailed structural-functional analysis of the Kruppel-like factor 16 (KLF16) transcription factor reveals novel mechanisms for silencing Sp/KLF sites involved in metabolism and endocrinology.
17688680 Observational study of gene-disease association. (HuGE Navigator)
15937668 Observational study of gene-disease association. (HuGE Navigator)
12036432 protein analysis of BTEB3 and BTEB4 and their binding to CYP1A1

AA Sequence

MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGP      1 - 70
GAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYK     71 - 140
SSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHP    141 - 210
GFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAPAGL                                211 - 252
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22203677 2012 Detailed structural-functional analysis of the Krüppel-like factor 16 (KLF16) transcription factor reveals novel mechanisms for silencing Sp/KLF sites involved in metabolism and endocrinology.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17688680 2007 Analysis of KLF transcription factor family gene variants in type 2 diabetes.
17480121 2007 Identification of the imprinted KLF14 transcription factor undergoing human-specific accelerated evolution.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
12036432 2002 Functional analysis of basic transcription element (BTE)-binding protein (BTEB) 3 and BTEB4, a novel Sp1-like protein, reveals a subfamily of transcriptional repressors for the BTE site of the cytochrome P4501A1 gene promoter.
11438660 2001 A conserved alpha-helical motif mediates the interaction of Sp1-like transcriptional repressors with the corepressor mSin3A.
11390978 2001 Dopamine receptor regulating factor, DRRF: a zinc finger transcription factor.