Property Summary

NCBI Gene PubMed Count 43
PubMed Score 19.67
PubTator Score 21.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease -1.549 8.2e-03
active ulcerative colitis -2.163 2.0e-03
adult high grade glioma 1.200 8.2e-04
Astrocytoma, Pilocytic 1.600 7.9e-08
atypical teratoid / rhabdoid tumor 1.900 4.2e-09
Breast cancer 2.900 2.7e-02
ependymoma 1.300 8.1e-11
glioblastoma 1.200 3.2e-07
group 4 medulloblastoma 1.500 1.3e-05
hereditary spastic paraplegia -1.054 1.3e-02
interstitial cystitis 1.200 1.4e-02
intraductal papillary-mucinous adenoma (... -1.100 3.0e-02
medulloblastoma, large-cell 1.300 4.1e-04
osteosarcoma 2.266 9.4e-05
ovarian cancer 1.200 9.1e-03
pancreatic ductal adenocarcinoma liver m... -2.258 7.4e-04
primary Sjogren syndrome 1.300 2.5e-03
primitive neuroectodermal tumor 1.700 3.0e-05
psoriasis -1.500 1.9e-03

Gene RIF (20)

AA Sequence

MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSL      1 - 70
SVDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSSSRLASSPTVITSVSSASSSS     71 - 140
TVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNVNNTI    141 - 210
VVPLLEDGRGHGKAQMDPRGLSPRQSKSDSDDDDLPNVTLDSVNETGSTALSIARAVQEVHPSPVSRVRG    211 - 280
NRMNNQKFPCSISPFSIESTRRQRRSESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCT    281 - 350
WEGCTWKFARSDELTRHYRKHTGVKPFKCADCDRSFSRSDHLALHRRRHMLV                      351 - 402
//

Text Mined References (48)

PMID Year Title