Property Summary

NCBI Gene PubMed Count 49
PubMed Score 43.35
PubTator Score 44.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
25931269 The data suggest a relationship between promoter DNA methylation and KLF11 gene expression in ovarian cancer tumorigenesis.
25504365 identified an evolutionarily conserved metabolic regulator, Kruppel-like factor 11 (KLF11), as a novel browning transcription factor in human adipocytes that is required for rosiglitazone-induced browning.
25502632 Results suggest a role for KLF11 in upregulating MAO-A in depressive disorder and chronic social stress, suggesting that inhibition of the pathways regulated by this transcription factor may aid in the therapeutics of neuropsychiatric illnesses
25076120 KLF11 repressed most endometrial CYP enzymes
24885560 KLF11 regulates distinct gene networks.
24069400 KLF11 is a critical transcription factor in the function of mesenchymal cells and, specifically, as a negative regulator of collagen secretion.
24060634 KLF111 represses glycodelin-A levels and influences its role in the ovarian endometrium.
23915421 Levels of KLF11 are significantly increased in the postmortem prefrontal cortex of subjects with alcohol dependence compared to controls.
23589285 The A347S mutation disrupted KLF11-mediated increases in basal insulin levels and promoter activity and blunted glucose-stimulated insulin secretion.
23555910 Data identify a novel pathogenic role for KLF11 in preventing de novo disease-associated fibrosis in endometriosis.
23042817 Kruppel-like factor-11, a transcription factor involved in diabetes mellitus, suppresses endothelial cell activation via the nuclear factor-kappaB signaling pathway.
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
22801105 KLF11 has a role in fine-tuning insulin transcription in certain cellular situations rather than representing a major transcriptional activator or repressor of the insulin gene.
22628545 KLF11 is an MAO A regulator and is produced in response to neuronal stress, which transcriptionally activates MAO A.
22375010 Here we report the characterization of two antagonistic, chromatin-mediated mechanisms by which KLF11 regulated the transcription of the dopamine D2 receptor.
22318730 A PXVXL HP1-interacting domain identified at position 487-491 of KLF11 mediates the binding of HP1alpha and KLF11 in vitro and in cultured cells.
21592955 an important role for KLF11 in the regulation of INS transcription via the novel c.-331 KLF site.
20709022 KLF11, but not KLF15, was essential for UCP1 expression during brown adipocyte differentiation of muBM3.1.
20154088 Kruppel-like factor 11 has a role in the regulation of prostaglandin E2 biosynthesis
20124487 KLF11 is an integrator of progesterone receptor signaling and proliferation in uterine leiomyoma cells.
20002157 epigenetic inactivation and subsequent transcriptional repression of the KLF11 gene is quite frequent in MDS.
19843526 MODY7 gene, KLF11, is a novel p300-dependent regulator of Pdx-1 (MODY4) transcription in pancreatic islet beta cells.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19122346 19 polymorphisms, 6 of which are novel, were identified, but none of them showed association with type 2 diabetes. Functional analyses of these variants showed reduced effects on transcriptional activities of insulin, catalase1, & the Smad7 gene.
19122346 Observational study of gene-disease association. (HuGE Navigator)
18593768 KLF11 is unlikely to play a major role in the etiology of T2 diabetes among this Native American population.
18593768 Observational study of gene-disease association. (HuGE Navigator)
18505768 KLF11 may interfere with glucose homeostasis in a Danish general population and that STAT3-mediated up-regulation of KLF11 transcription was impaired by the -1659G>C variant.
18505768 Observational study of gene-disease association. (HuGE Navigator)
18199129 Observational study of gene-disease association. (HuGE Navigator)
17479246 Kruppel-like factor 11 inhibits human proinsulin promoter activity in pancreatic beta cells
17308981 TIEG2 decreases the levels of the anti-apoptotic protein Bcl-X(L) and inhibits transcription driven by the Bcl-X(L) promoter.
17252542 results may help to increase the understanding of Tieg3-mediated transcriptional control and to characterize this TGF-beta-induced Sp1/Klf-like transcription factor
17130512 Observational study of gene-disease association. (HuGE Navigator)
17130512 KLF11 A347S and T220M mutations do not contribute to increased risk of diabetes in European-derived populations.
17114344 These results suggest a central role for KLF11 in TGFbeta-induced c-myc repression and antiproliferation.
15774581 Observational study of gene-disease association. (HuGE Navigator)
15774581 KLF11 plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
15531587 in the presence of cholesterol, KLF11 acts as a dominant repressor of the caveolin-1 gene
15300592 novel mechanism in TGF-beta-regulated gene expression: KLF11 potentiates Smad-signaling activity in normal epithelial cells through termination of the negative feedback loop imposed by Smad7.
15024015 TIEG2 is an activator of Monoamine oxidase B gene expression.

AA Sequence

MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIR      1 - 70
PLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQ     71 - 140
SSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGH    141 - 210
FETLQDTHLTDSLLSTNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSV    211 - 280
PAPPVLCQMIPVTGQSSMLPAFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPP    281 - 350
PAPCAANVMAAGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG    351 - 420
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVG    421 - 490
KLNRIASAESPGSPLVSMPASA                                                    491 - 512
//

Text Mined References (52)

PMID Year Title
25931269 2015 Promoter DNA methylation is associated with KLF11 expression in epithelial ovarian cancer.
25504365 2015 Browning of human adipocytes requires KLF11 and reprogramming of PPAR? superenhancers.
25502632 2015 Evidence revealing deregulation of the KLF11-MAO A pathway in association with chronic stress and depressive disorders.
25416956 2014 A proteome-scale map of the human interactome network.
25076120 2014 Epigenetic regulation of uterine biology by transcription factor KLF11 via posttranslational histone deacetylation of cytochrome p450 metabolic enzymes.
24885560 2014 Single and combinatorial chromatin coupling events underlies the function of transcript factor Krüppel-like factor 11 in the regulation of gene networks.
24069400 2013 Role for Krüppel-like transcription factor 11 in mesenchymal cell function and fibrosis.
24060634 2014 KLF11 epigenetically regulates glycodelin-A, a marker of endometrial biology via histone-modifying chromatin mechanisms.
23915421 2014 The expression of KLF11 (TIEG2), a monoamine oxidase B transcriptional activator in the prefrontal cortex of human alcohol dependence.
23589285 2013 Krüppel-like factor 11 regulates the expression of metabolic genes via an evolutionarily conserved protein interaction domain functionally disrupted in maturity onset diabetes of the young.
23555910 2013 A novel role of the Sp/KLF transcription factor KLF11 in arresting progression of endometriosis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042817 2012 Krüppel-like factor-11, a transcription factor involved in diabetes mellitus, suppresses endothelial cell activation via the nuclear factor-?B signaling pathway.
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
22801105 2012 Human Krüppel-like factor 11 differentially regulates human insulin promoter activity in ?-cells and non-?-cells via p300 and PDX1 through the regulatory sites A3 and CACCC box.
22628545 2012 Mechanistic role for a novel glucocorticoid-KLF11 (TIEG2) protein pathway in stress-induced monoamine oxidase A expression.
22375010 2012 Krüppel-like factor 11 differentially couples to histone acetyltransferase and histone methyltransferase chromatin remodeling pathways to transcriptionally regulate dopamine D2 receptor in neuronal cells.
22318730 2012 Sequence-specific recruitment of heterochromatin protein 1 via interaction with Krüppel-like factor 11, a human transcription factor involved in tumor suppression and metabolic diseases.
21592955 2011 Disruption of a novel Kruppel-like transcription factor p300-regulated pathway for insulin biosynthesis revealed by studies of the c.-331 INS mutation found in neonatal diabetes mellitus.
21171965 2011 A functional family-wide screening of SP/KLF proteins identifies a subset of suppressors of KRAS-mediated cell growth.
20709022 2010 Transcriptional regulation of a brown adipocyte-specific gene, UCP1, by KLF11 and KLF15.
20154088 2010 Distinct role of Kruppel-like factor 11 in the regulation of prostaglandin E2 biosynthesis.
20124487 2010 Transcription factor KLF11 integrates progesterone receptor signaling and proliferation in uterine leiomyoma cells.
20002157 2010 Epigenetic inactivation of tumour suppressor gene KLF11 in myelodysplastic syndromes*.
19843526 2009 MODY7 gene, KLF11, is a novel p300-dependent regulator of Pdx-1 (MODY4) transcription in pancreatic islet beta cells.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19122346 2009 Identification of minimal promoter and genetic variants of Kruppel-like factor 11 gene and association analysis with type 2 diabetes in Japanese.
18593768 2008 Association analysis of Krüppel-like factor 11 variants with type 2 diabetes in Pima Indians.
18505768 2008 Genetic analysis of Kruppel-like zinc finger 11 variants in 5864 Danish individuals: potential effect on insulin resistance and modified signal transducer and activator of transcription-3 binding by promoter variant -1659G>C.
18199129 2008 The association of genetic variants in Krüppel-like factor 11 and Type 2 diabetes in the Japanese population.
17479246 2007 Human Krüppel-like factor 11 inhibits human proinsulin promoter activity in pancreatic beta cells.
17308981 2007 Human TIEG2/KLF11 induces oligodendroglial cell death by downregulation of Bcl-XL expression.
17252542 2007 Functional domains of the TGF-beta-inducible transcription factor Tieg3 and detection of two putative nuclear localization signals within the zinc finger DNA-binding domain.
17130512 2006 The Krüppel-like factor 11 (KLF11) Q62R polymorphism is not associated with type 2 diabetes in 8,676 people.
17114344 2006 The tumor suppressor KLF11 mediates a novel mechanism in transforming growth factor beta-induced growth inhibition that is inactivated in pancreatic cancer.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16131492 2005 {gamma}-Globin gene expression in chemical inducer of dimerization (CID)-dependent multipotential cells established from human {beta}-globin locus yeast artificial chromosome ({beta}-YAC) transgenic mice.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15774581 2005 Role of transcription factor KLF11 and its diabetes-associated gene variants in pancreatic beta cell function.
15531587 2005 KLF11-mediated repression antagonizes Sp1/sterol-responsive element-binding protein-induced transcriptional activation of caveolin-1 in response to cholesterol signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300592 2004 KLF11 mediates a critical mechanism in TGF-beta signaling that is inactivated by Erk-MAPK in pancreatic cancer cells.
15024015 2004 Dual functions of transcription factors, transforming growth factor-beta-inducible early gene (TIEG)2 and Sp3, are mediated by CACCC element and Sp1 sites of human monoamine oxidase (MAO) B gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12006497 2002 Signaling disrupts mSin3A binding to the Mad1-like Sin3-interacting domain of TIEG2, an Sp1-like repressor.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11438660 2001 A conserved alpha-helical motif mediates the interaction of Sp1-like transcriptional repressors with the corepressor mSin3A.
11087666 2000 Identification of KLF13 and KLF14 (SP6), novel members of the SP/XKLF transcription factor family.
10207080 1999 FKLF, a novel Krüppel-like factor that activates human embryonic and fetal beta-like globin genes.
9748269 1998 Molecular cloning and characterization of TIEG2 reveals a new subfamily of transforming growth factor-beta-inducible Sp1-like zinc finger-encoding genes involved in the regulation of cell growth.