Property Summary

NCBI Gene PubMed Count 65
PubMed Score 102.10
PubTator Score 63.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.500 1.6e-02
aldosterone-producing adenoma -1.633 6.9e-03
atypical teratoid / rhabdoid tumor 1.200 9.8e-04
Breast cancer -1.700 7.7e-16
chronic lymphosyte leukemia -1.600 3.1e-04
colon cancer -1.900 3.8e-04
ependymoma 1.600 3.3e-07
glioblastoma 1.500 1.5e-04
interstitial lung disease -1.100 4.8e-02
intraductal papillary-mucinous adenoma (... -1.600 1.2e-03
intraductal papillary-mucinous carcinoma... -1.500 3.7e-04
lung cancer -2.400 1.6e-05
lung carcinoma -1.200 2.1e-09
non-small cell lung cancer -1.011 5.0e-11
osteosarcoma 1.118 5.5e-03
ovarian cancer -2.400 1.7e-06
primitive neuroectodermal tumor 1.100 4.4e-03
psoriasis 1.400 7.0e-04
sonic hedgehog group medulloblastoma 1.400 2.3e-02
ulcerative colitis -1.006 4.2e-02

 GO Component (1)

Gene RIF (37)

AA Sequence

MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSD      1 - 70
LSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKS     71 - 140
PVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRS    141 - 210
KCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLP    211 - 280
ANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGF    281 - 350
SPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR    351 - 420
RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ              421 - 480
//

Text Mined References (69)

PMID Year Title