Property Summary

NCBI Gene PubMed Count 80
PubMed Score 199.55
PubTator Score 125.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.300 2.1e-04
osteosarcoma -6.702 1.5e-08
psoriasis 1.100 3.1e-03

Gene RIF (67)

AA Sequence

MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGAD      1 - 70
ATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPAL     71 - 140
RARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAP    141 - 210
QYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHT    211 - 280
CAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSR    281 - 350
SDHLALHMKRHL                                                              351 - 362
//

Text Mined References (82)

PMID Year Title