Property Summary

NCBI Gene PubMed Count 30
PubMed Score 4.64
PubTator Score 6.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.100 1.9e-20
glioblastoma -1.400 1.4e-09
oligodendroglioma -1.200 5.5e-16
posterior fossa group B ependymoma -1.700 1.7e-10
sonic hedgehog group medulloblastoma -1.700 1.1e-05
atypical teratoid/rhabdoid tumor -1.400 3.2e-06
pediatric high grade glioma -1.200 4.5e-06
pilocytic astrocytoma -1.300 3.1e-06
lung carcinoma 1.200 6.2e-34

Gene RIF (4)

PMID Text
26385635 a homozygous 216-bp deletion located at the non-coding upstream region of the KLC2 gene in patients with SPOAN syndrome causes overexpression of the gene
25668010 Results identified KLC2 as a novel target and of miR-125b in non-small-cell lung cancer (NSCLC) and show the oncogenic potential of KLC2 in the progression of NSCLC.
22470497 For the binding of cargos shared by KLC2, we propose a different site located within the groove but not involving N343.
19773350 Na,K-ATPase traffic toward the plasma membrane in alveolar epithelial cells is driven by kinesin-1, where KLC2 is the isoform regulating this process.

AA Sequence

MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL      1 - 70
GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM     71 - 140
SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS    141 - 210
QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA    211 - 280
VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA    281 - 350
LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE    351 - 420
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK    421 - 490
VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML    491 - 560
VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG            561 - 622
//

Text Mined References (38)

PMID Year Title
26884162 2016 The light chains of kinesin-1 are autoinhibited.
26385635 2015 Overexpression of KLC2 due to a homozygous deletion in the non-coding region causes SPOAN syndrome.
25668010 2015 High expression of kinesin light chain-2, a novel target of miR-125b, is associated with poor clinical outcome of elderly non-small-cell lung cancer patients.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22470497 2012 Crystal structures of the tetratricopeptide repeat domains of kinesin light chains: insight into cargo recognition mechanisms.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20510358 2010 Effects of ALS-related SOD1 mutants on dynein- and KIF5-mediated retrograde and anterograde axonal transport.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19773350 2010 Role of kinesin light chain-2 of kinesin-1 in the traffic of Na,K-ATPase-containing vesicles in alveolar epithelial cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14985359 2004 A direct interaction between cytoplasmic dynein and kinesin I may coordinate motor activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11106729 2000 Kinesin-dependent axonal transport is mediated by the sunday driver (SYD) protein.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9624122 1998 Two kinesin light chain genes in mice. Identification and characterization of the encoded proteins.