Property Summary

NCBI Gene PubMed Count 25
PubMed Score 69.87
PubTator Score 19.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
25727012 ATF4 signaling pathway is essential for mediating the effect of ER stress on beta-klotho expression.
25070056 Variants in genes involved in feedback regulation of bile acid synthesis (KLB, P=0.06 and FGFR4, P=0.09) were potentially associated with the irritable bowel syndrome-diarrhea subgroup with elevated serum C4.
24813368 obesity appears as the predominant determinant of the abnormalities in FGF21 and FGF19 levels. Opposite changes in beta-Klotho expression in fat and liver indicate potential tissue-specific alterations in the responsiveness to endocrine FGFs in obesity
24200957 In-depth DNA sequencing identified additional genetic coding and noncoding variants in KLB that are associated with fecal bile acids excretion or colonic transit in Irritable bowel syndrome-diarrhea.
23383245 betaKlotho suppresses tumor growth in hepatocellular carcinoma by regulating Akt/GSK-3beta/cyclin D1 signaling pathway.
22523080 KLB and FGFR1 form a 1:1 heterocomplex independent of the galectin lattice that transitions to a 1:2 complex upon the addition of FGF21.
22442730 Differential specificity of endocrine FGF19 and FGF21 to FGFR1 and FGFR4 in complex with KLB.
22439738 KLB-silencing in Huh7 cells decreased cell proliferation and suppressed FGFR4 downstream signaling.
22271411 Polymorphism KLB rs4975017 may influence the colonic transit response to colesevelam in female patients with irritable bowel syndrome with diarrhea.
22248288 Deletion of the D1 and the D1-D2 linker (the D1/linker region) from FGFR1c led to beta-Klotho-independent receptor activation by FGF21, suggesting that there may be a direct interaction between FGF21 and the D1/linker region-deficient FGFR1c.
22020932 Data suggest that KLB is an important regulator in the immortalization of HCECs by facilitating FGF19 growth factor signaling.
21653700 Sulfated glycosaminoglycans are required for specific and sensitive fibroblast growth factor (FGF) 19 signaling via FGF receptor 4 and betaKlotho.
21396369 A functional KLB gene variant mediating protein stability associates with colonic transit in irritable bowel syndrome with diarrhea. This association is modulated by 2 genetic variants in FGFR4.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20717167 Observational study of gene-disease association. (HuGE Navigator)
20657013 Metabolic regulator betaKlotho interacts with fibroblast growth factor receptor 4 (FGFR4) to induce apoptosis and inhibit tumor cell proliferation.
19059246 These data demonstrate that the C-terminus of FGF21 is critical for binding to beta-Klotho and the N-terminus is critical for fibroblast growth factor receptor (FGFR) activation.
18829467 Both FGF23 and FGF21 require intact alpha or betaKlotho for signaling, respectively, whereas FGF19 can signal through a Klotho chimera consisting of the N terminus of alphaKlotho and the C terminus of betaKlotho.
18259951 High expression of Klotho is associated with ovarian disease progression
17711860 a functional FGF19 receptor may consist of FGF receptor (FGFR) and heparan sulfate complexed with either alphaKlotho or betaKlotho
17627937 Liver-specific activities of FGF19 require Klotho beta.
16358222 The down-regulation of the renal klotho gene could increase renal damage induced by angiotensin II, while klotho gene induction could have therapeutic possibilities in treating angiotensin II-induced kidney damage.

AA Sequence

MKPGCAAGSPGNEWIFFSTDEITTRYRNTMSNGGLQRSVILSALILLRAVTGFSGDGRAIWSKNPNFTPV      1 - 70
NESQLFLYDTFPKNFFWGIGTGALQVEGSWKKDGKGPSIWDHFIHTHLKNVSSTNGSSDSYIFLEKDLSA     71 - 140
LDFIGVSFYQFSISWPRLFPDGIVTVANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWK    141 - 210
NDTIIDIFNDYATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNLIKAHSKV    211 - 280
WHNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFS    281 - 350
VLPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWF    351 - 420
TDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKER    421 - 490
KPKSSAHYYKQIIRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPESVASSPQFSDPHLYVWNATGNRL    491 - 560
LHRVEGVRLKTRPAQCTDFVNIKKQLEMLARMKVTHYRFALDWASVLPTGNLSAVNRQALRYYRCVVSEG    561 - 630
LKLGISAMVTLYYPTHAHLGLPEPLLHADGWLNPSTAEAFQAYAGLCFQELGDLVKLWITINEPNRLSDI    631 - 700
YNRSGNDTYGAAHNLLVAHALAWRLYDRQFRPSQRGAVSLSLHADWAEPANPYADSHWRAAERFLQFEIA    701 - 770
WFAEPLFKTGDYPAAMREYIASKHRRGLSSSALPRLTEAERRLLKGTVDFCALNHFTTRFVMHEQLAGSR    771 - 840
YDSDRDIQFLQDITRLSSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITASGIDDQALEDDRLRKYYLGKY    841 - 910
LQEVLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTSDFKAKSSIQFYNKVISSRGFPFENSSSRCSQTQ    911 - 980
ENTECTVCLFLVQKKPLIFLGCCFFSTLVLLLSIAIFQRQKRRKFWKAKNLQHIPLKKGKRVVS          981 - 1044
//

Text Mined References (25)

PMID Year Title
25727012 2015 Endoplasmic reticulum stress induces up-regulation of hepatic ?-Klotho expression through ATF4 signaling pathway.
25070056 2014 Effect of increased bile acid synthesis or fecal excretion in irritable bowel syndrome-diarrhea.
24813368 2015 Opposite alterations in FGF21 and FGF19 levels and disturbed expression of the receptor machinery for endocrine FGFs in obese patients.
24200957 2014 Irritable bowel syndrome-diarrhea: characterization of genotype by exome sequencing, and phenotypes of bile acid synthesis and colonic transit.
23383245 2013 ?Klotho suppresses tumor growth in hepatocellular carcinoma by regulating Akt/GSK-3?/cyclin D1 signaling pathway.
22523080 2012 Dynamics and Distribution of Klotho? (KLB) and fibroblast growth factor receptor-1 (FGFR1) in living cells reveal the fibroblast growth factor-21 (FGF21)-induced receptor complex.
22442730 2012 Differential specificity of endocrine FGF19 and FGF21 to FGFR1 and FGFR4 in complex with KLB.
22439738 2012 Klotho-beta overexpression as a novel target for suppressing proliferation and fibroblast growth factor receptor-4 signaling in hepatocellular carcinoma.
22271411 2012 Pharmacogenetics of the effects of colesevelam on colonic transit in irritable bowel syndrome with diarrhea.
22248288 2012 Understanding the physical interactions in the FGF21/FGFR/?-Klotho complex: structural requirements and implications in FGF21 signaling.
22020932 2011 Short hairpin RNA screen indicates that Klotho beta/FGF19 protein overcomes stasis in human colonic epithelial cells.
21653700 2011 Sulfated glycosaminoglycans are required for specific and sensitive fibroblast growth factor (FGF) 19 signaling via FGF receptor 4 and betaKlotho.
21396369 2011 A Klotho? variant mediates protein stability and associates with colon transit in irritable bowel syndrome with diarrhea.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20717167 2010 FGF21 signalling pathway and metabolic traits - genetic association analysis.
20657013 2010 Metabolic regulator betaKlotho interacts with fibroblast growth factor receptor 4 (FGFR4) to induce apoptosis and inhibit tumor cell proliferation.
19117008 2009 Different roles of N- and C- termini in the functional activity of FGF21.
19059246 2009 FGF21 N- and C-termini play different roles in receptor interaction and activation.
18829467 2008 C-terminal tail of FGF19 determines its specificity toward Klotho co-receptors.
18259951 2008 Klotho expression in epithelial ovarian cancer and its association with insulin-like growth factors and disease progression.
17711860 2007 Co-receptor requirements for fibroblast growth factor-19 signaling.
17627937 2007 Liver-specific activities of FGF19 require Klotho beta.
16358222 The klotho gene: a gene predominantly expressed in the kidney is a fundamental regulator of aging and calcium/phosphorus metabolism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.