Property Summary

NCBI Gene PubMed Count 285
PubMed Score 790.59
PubTator Score 440.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Skin cancer 469 0.0 0.5

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis -1.700 2.3e-05
ductal carcinoma in situ -1.800 4.8e-05
group 4 medulloblastoma 4.300 1.2e-06
invasive ductal carcinoma -2.100 8.0e-05
lung adenocarcinoma -2.100 1.9e-18
lung cancer -1.200 3.8e-04
non-small cell lung cancer -1.957 3.9e-23
pituitary cancer 1.700 4.8e-04

Gene RIF (287)

AA Sequence

MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVG      1 - 70
SAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALR     71 - 140
ELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGWANR    141 - 210
ALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWH    211 - 280
LYNTSFRPTQGGQVSIALSSHWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP    281 - 350
DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS    351 - 420
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLP    421 - 490
KSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKV    491 - 560
DGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASELVRVN    561 - 630
ITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG    631 - 700
HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDY    701 - 770
PWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN    771 - 840
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLC    841 - 910
GYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLERFCPEEFTVCTECSFFHTRK    911 - 980
SLLAFIAFLFFASIISLSLIFYYSKKGRRSYK                                          981 - 1012
//

Text Mined References (286)

PMID Year Title