Property Summary

Ligand Count 372
NCBI Gene PubMed Count 953
PubMed Score 6371.89
PubTator Score 3954.07

Knowledge Summary

Patent (315,733)

TINX Plot

  Disease (9)

Disease Target Count
Intestinal Obstruction 31
Constipation 181
Abnormal blistering of the skin 54
Abnormality of metabolism/homeostasis 134
Absent pigmentation of the ventral chest 2
Acute Myeloid Leukemia (AML-M2) 3
Acute Promyelocytic Leukemia 40
Acute myelomonocytic leukemia 5
Blister of skin 54
Congenital ear anomaly NOS (disorder) 29
Cryptorchidism 296
Cutaneous Mastocytosis 1
Deglutition Disorders 132
Diffusely thickened skin 20
Dyschezia 135
Eosinophilia 28
Erythema 58
Ewings sarcoma-primitive neuroectodermal tumor (PNET) 3
Exfoliative dermatitis 24
Fatigue 182
Flushing 60
Gastrointestinal Hemorrhage 52
Gonadal Dysgenesis 28
Gonadal Dysgenesis, Mixed 19
Heterochromia iridis 9
Hirschsprung Disease 31
Hyperpigmentation 37
Hyperpigmented macules 42
Hypoplastic myelodysplasia 18
Increased gastric cancer 21
Isolated cases 72
Large hand 18
Leukemia, Myelocytic, Acute 120
Leukemia, Myelomonocytic, Chronic 3
MYELODYSPLASTIC SYNDROME 53
Macule 19
Mammary Neoplasms 425
Megacolon 29
Multiple, subcutaneous nodules 53
Myeloid Leukemia, Chronic 23
Nausea and vomiting 97
Neurofibromatoses 5
Pachyderma 20
Profuse pigmented skin lesions 2
Pruritus 58
Pure gonadal dysgenesis 19
Sarcoma 62
Skin Mastocytoma 1
Skin bulla 54
Small cell carcinoma of lung 45
Somatic mutation 61
Stomach Neoplasms 300
Subcutaneous nodule 53
Systemic mastocytosis with associated clonal, hematologic non-mast-cell lineage disease 1
Telangiectasia macularis eruptiva perstans 1
Teratoma 8
Urticaria 67
White forelock 12
hypopigmented skin patch 59
malignant mesothelioma 3232
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.1
Disease Target Count Z-score Confidence
Cancer 2499 7.009 3.5

Expression

  Differential Expression (29)

Disease log2 FC p
Breast cancer -5.500 2.4e-23
ovarian cancer -1.200 4.6e-04
adrenocortical carcinoma 2.055 2.2e-03
adult high grade glioma -2.100 2.7e-04
astrocytic glioma -2.100 5.0e-03
Astrocytoma, Pilocytic -1.700 4.1e-06
atypical teratoid / rhabdoid tumor -2.700 2.9e-06
breast carcinoma -2.200 4.2e-04
colon cancer -2.600 5.2e-03
cutaneous lupus erythematosus -1.600 4.3e-03
cystic fibrosis -3.210 9.2e-07
ependymoma -1.900 7.2e-07
glioblastoma -1.800 2.9e-04
group 4 medulloblastoma -2.200 2.8e-05
intraductal papillary-mucinous adenoma (... -1.500 1.3e-02
intraductal papillary-mucinous neoplasm ... -2.000 2.1e-02
lung adenocarcinoma -1.300 3.5e-07
lung cancer -2.200 7.4e-04
lung carcinoma -1.600 7.0e-07
medulloblastoma, large-cell -3.300 1.9e-04
mucosa-associated lymphoid tissue lympho... -1.519 1.2e-02
non-small cell lung cancer -1.714 7.1e-09
osteosarcoma -2.162 1.1e-04
pituitary cancer -1.500 2.1e-03
psoriasis -1.400 2.2e-06
subependymal giant cell astrocytoma -2.672 5.5e-03
tuberculosis -2.800 2.0e-06
ulcerative colitis 1.300 5.1e-03
Waldenstrons macroglobulinemia 1.081 1.0e-02

 CSPA Cell Line (1)

PDB (17)

Gene RIF (867)

AA Sequence

MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEI      1 - 70
LDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD     71 - 140
PEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKA    141 - 210
VPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSA    211 - 280
RVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIY    281 - 350
MNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR    351 - 420
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVE    421 - 490
CKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVV    491 - 560
EEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAH    561 - 630
LTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEA    631 - 700
ALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLL    701 - 770
SFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES    771 - 840
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDAD    841 - 910
PLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV        911 - 976
//

Text Mined References (965)

PMID Year Title