Property Summary

NCBI Gene PubMed Count 139
PubMed Score 143.91
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (125)

PMID Text
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26109640 The data from this study contribute novel insight into how KIR3DS1-specific polymorphisms in the extracellular region impact KIR3DL1 surface expression, ligand binding, and inhibitory function.
25636577 genetic polymorphism is not related to acute myeloid leukemia in Chinese population
25491925 Moreover, the frequency of activating genotypes in the AS patient group was significantly higher than in the healthy control group (P < 0.05). KIR2DS1 and KIR3DS1
25253288 Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load.
25112829 Protective genotypes in HIV infection reflect superior function of KIR3DS1 over KIR3DL1-expressing CD8+ T cells.
24407110 KIR2DL3 and KIR3DS1 genes could be protector genes and immuno-genetic markers for Hepatits B in the Turkish population.
24059286 Different KIR3DS1, KIR3DL1 and HLA-Bw4 genotypes and levels of transcripts associate with HIV disease progression.
23789883 results suggest that the sole presence of KIR3DS1 could have a protective role in HIV-1 infection in highly exposed and persistently seronegative individuals
23613999 Results show that the KIR3DS1 genotype has a positive effect on HCV viral clearance during the first weeks of Peg-IFN/RBV treatment in HCV/HCV co-infected patients bearing genotype 1, and higher RVR and SVR rates.
23524032 Report reliable and accurate method for genotyping KIR3DL1/S1 using DNA recovered from plasma.
23325834 Our data revealed a unique contribution of activating KIRs (KIR2DS4, KIR2DS2, or KIR3DS1), in addition to NKG2C, in the expansion of human natural killer cells.
22744805 KIR3DS1, in addition to HLA-B27, may play an important independent role in the pathogenesis of ankylosing spondylitis in the Chinese population.
22653583 Data found that the frequencies of KIR2DS1, 2DS3 and 3DS1 were significantly higher in pulmonary tuberculosis patients than in the control group.
22652695 Data indicate that killer-cell immunoglobulin-like receptors (KIRs)activator (KIR3DS1 and KIR2DS5) and inhibitory (KIR2DL5) genes are associated with severe pandemic influenza A (H1N1) 2009 infections.
22426166 Data suggest that low level of activating KIR3DS1 and its combination with HLA-B Bw4Ile80 ligand might have an influence on the susceptibility to tuberculosis (TB) in Lur population of Iran.
21804024 These data provide the first evidence for the direct binding of KIR3DS1(+) cells to HLA-Bw4 and highlight the key role for position 138 in determining ligand specificity of KIR3DS1
21779711 There is evidence of the association of activating KIR genotypes with an increased risk for autoimmune disease
21665278 Our results that KIR2DL5 and KIR3DS1 may have a predisposing role in multiple sclerosis
21233146 predisposition to systemic lupus erythematosus was associated with GTGT deletion at the SLC11A1 3'UTR, presence of KIR2DS2 +/KIR2DS5 +/KIR3DS1 + profile, increased number of stimulatory KIR genes and European and Amerindian ancestries
20878400 Observational study of gene-disease association. (HuGE Navigator)
20818412 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20562327 The most significant difference in PFS observed in multiple myeloma patients after autologous stem cell transplantation was with those with GR KIR3DS1(+) in whom HLA-Bw4, the ligand for the corresponding inhibitory receptor KIR3DL1, was missing
20528243 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20371502 Observational study of gene-disease association. (HuGE Navigator)
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20230527 KIR3DL1 and KIR3DS1 allele frequencies were determined by DNA sequencing of the complete coding regions from 100 random unrelated African Americans
20230527 Observational study of genotype prevalence. (HuGE Navigator)
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20207982 Observational study of gene-disease association. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20137308 Observational study of gene-disease association. (HuGE Navigator)
20131260 The increased frequency of the KIR3DS1*013 allele in patients with amnkylosing spondylitis is clearly independent of the presence of the HLA-Bw4I80 epitope.
20124216 Compared with KIR3DS1(-) donors, donor KIR3DS1 was associated with lower-grade II-IV acute graft-versus-host disease.
20124216 Observational study of gene-disease association. (HuGE Navigator)
20082646 Observational study of genotype prevalence. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
19968064 Observational study of gene-disease association. (HuGE Navigator)
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19926642 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19897003 individuals carrying three activating KIR genes 3DS1, 2DS1, and 2DS5 are more frequent in patients with Vogt-Koyanagi-Harada disease than in controls
19897003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19875891 Observational study of gene-disease association. (HuGE Navigator)
19874556 no association in frequencies of the alleles of these gene in ankylosing spondylitis
19874556 Observational study of gene-disease association. (HuGE Navigator)
19861144 KIR3DS1 and KIR2DS1 may be necessary to trigger an effective early immune response against HPV-infected targets to establish resistance to recurrent respiratory papillomatosis
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19859704 Data revealed that the trend of parasitic positive individuals to be KIR3DL1/KIR3DS1 heterozygous in pair with KIR2DS4 nondeleted variants in a set of KIR genes inheritable as the AB genotypes.
19859704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19761533 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19664392 Observational study of gene-disease association. (HuGE Navigator)
19630074 Observational study of gene-disease association. (HuGE Navigator)
19527230 Observational study of gene-disease association. (HuGE Navigator)
19522772 Observational study of genetic testing. (HuGE Navigator)
19493232 Observational study of gene-disease association. (HuGE Navigator)
19489269 Observational study of gene-disease association. (HuGE Navigator)
19454667 KIR3DS1 expression on NK cells can be induced after exposure to stimulator cells
19450876 Observational study of gene-disease association. (HuGE Navigator)
19421224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19386717 Persistence of KIR3DS1+ and KIR3DL1+ NK cells during acute HIV1 infection is HLA class I-dependent.
19326408 Observational study of gene-disease association. (HuGE Navigator)
19309280 Observational study of gene-disease association. (HuGE Navigator)
19279038 Observational study of gene-disease association. (HuGE Navigator)
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19211742 Observational study of gene-disease association. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
19046302 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19032228 Observational study of gene-disease association. (HuGE Navigator)
19019897 Observational study of gene-disease association. (HuGE Navigator)
19008943 The frequency of KIR3DL1/S1 subtype expression on NK cells contribute to the phenotypic variation across allotypes with respect to disease resistance.
19000141 Observational study of genotype prevalence. (HuGE Navigator)
18945962 Observational study of gene-disease association. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18830515 Observational study of genotype prevalence. (HuGE Navigator)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18687225 Observational study of gene-disease association. (HuGE Navigator)
18668235 Observational study of genotype prevalence. (HuGE Navigator)
18643961 Observational study of gene-disease association. (HuGE Navigator)
18638658 3DL1/3DS1 demonstrated an increased frequency in ankylosing spondylitis (p(c) < 0.005 in the Chinese population and p(c) < 0.05 in the Thai population)
18638658 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18351333 Observational study of genotype prevalence. (HuGE Navigator)
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18331531 in bone marrow transplant patients alleles 3DL1*00101 & *002 were most frequently observed in addition to 12 other known 3DL1 alleles; A single 3DS1 allele, 3DS1*01301, was identified; two new alleles, 3DL1*01702 and 3DS1*058, were characterized
18331531 Observational study of gene-disease association. (HuGE Navigator)
18317000 Observational study of gene-disease association. (HuGE Navigator)
18305035 We observed that possessing KIR3DS1 was associated with higher NK cell effector functions in early HIV-1 disease, despite the absence of HLA Bw4Ile80, a putative ligand of KIR3DS1.
18297378 Observational study of gene-disease association. (HuGE Navigator)
18074414 Observational study of gene-disease association. (HuGE Navigator)
18025129 Variation at the KIR locus influences the effectiveness of NK cell activity in the containment of viral replication.
17997746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17990989 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17882223 Observational study of gene-disease association. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17694054 KIR3DL1/S1 is under balancing selection in most human populations except Africans. KIR3DL1/S1 is co-evolving with Bw4 ligand of HLA-A and B.
17687550 Sequencing analysis identified a variant with a complex deletion/substitution mutation in exon 4 (which encodes the D1 extracellular domain), resulting in a premature stop codon and might affect its expression and activating capacity
17592337 Carriage of activating 3ds1 was increased in patients with herpes virus RDs.
17490516 Observational study of gene-disease association. (HuGE Navigator)
17301953 In 3DS1/3DL1 heterozygous donors significant numbers of natural killer (NK) cells express 3DS1 without co-expressing 3DL1 and that NK cells expressing both alleles are difficult to detect.
17200871 Observational study of genotype prevalence. (HuGE Navigator)
16698433 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16698429 Observational study of genotype prevalence. (HuGE Navigator)
16508981 Observational study of gene-disease association. (HuGE Navigator)
15942906 Observational study of gene-disease association. (HuGE Navigator)
15896204 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPI      1 - 70
FHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERV     71 - 140
ILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPS    141 - 210
DPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKI    281 - 350
PFTILLFFLLHRWCSNKKNAAVMDQEPAGNRSEQRGF                                     351 - 387
//

Text Mined References (141)

PMID Year Title
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26109640 2015 KIR3DS1-Specific D0 Domain Polymorphisms Disrupt KIR3DL1 Surface Expression and HLA Binding.
25636577 2015 Comparison of the KIR3DS1/Bw4 distribution in Chinese healthy and acute myeloid leukemia individuals.
25491925 2015 Activating killer immunoglobulin-like receptors genes are associated with increased susceptibility to ankylosing spondylitis.
25253288 2014 Killer immunoglobulin-like receptor gene repertoire influences viral load of primary human cytomegalovirus infection in renal transplant patients.
25112829 2015 Protective genotypes in HIV infection reflect superior function of KIR3DS1+ over KIR3DL1+ CD8+ T cells.
24601832 2014 A novel full-length KIR3DS1*0130106 allele identified by sequencing.
24499056 2014 The KIR3DS1*0130105 allele identified using high-resolution sequence-based typing.
24407110 2014 Role of KIR genes and genotypes in susceptibility to or protection against hepatitis B virus infection in a Turkish cohort.
24405495 2014 Identification of the KIR3DL1*0050105 allele by sequence-based techniques.
24308671 2014 Report of a novel KIR3DS1*0130104 allele discovered using advanced molecular techniques.
24059286 2013 KIR3DS1/L1 and HLA-Bw4-80I are associated with HIV disease progression among HIV typical progressors and long-term nonprogressors.
23789883 2013 KIR-HLA-A and B alleles of the Bw4 epitope against HIV infection in discordant heterosexual couples in Chaco Argentina.
23613999 2013 Natural killer KIR3DS1 is closely associated with HCV viral clearance and sustained virological response in HIV/HCV patients.
23524032 2013 A method for killer-cell immunoglobulin-like receptor (KIR) 3DL1/3DS1 genotyping using DNA recovered from frozen plasma.
23394822 2013 Recombinant structures expand and contract inter and intragenic diversification at the KIR locus.
23325834 2013 NK cell responses to cytomegalovirus infection lead to stable imprints in the human KIR repertoire and involve activating KIRs.
22744805 2013 Association of KIR genotype with susceptibility to HLA-B27-positive ankylosing spondylitis.
22653583 2012 Association of killer cell immunoglobulin-like receptors with pulmonary tuberculosis in Chinese Han.
22652695 2012 Killer-cell immunoglobulin-like receptors (KIR) in severe A (H1N1) 2009 influenza infections.
22426166 2012 Association of KIR3DS1+HLA-B Bw4Ile80 combination with susceptibility to tuberculosis in Lur population of Iran.
21804024 2011 Analysis of binding of KIR3DS1*014 to HLA suggests distinct evolutionary history of KIR3DS1.
21779711 Autoimmune rheumatic diseases and their association with killer immunoglobulin-like receptor genes.
21665278 2011 Killer cell immunoglobulin-like receptor genes in Spanish multiple sclerosis patients.
21233146 2011 Systemic lupus erythematosus: association with KIR and SLC11A1 polymorphisms, ethnic predisposition and influence in clinical manifestations at onset revealed by ancestry genetic markers in an urban Brazilian population.
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20818412 2010 Contribution of functional KIR3DL1 to ankylosing spondylitis.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20562327 2010 Interaction between KIR3DS1 and HLA-Bw4 predicts for progression-free survival after autologous stem cell transplantation in patients with multiple myeloma.
20528243 2010 Killer cell immunoglobulin-like receptor gene polymorphism in lymphoproliferative diseases of granular lymphocytes in a Japanese population.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20371502 2010 Association of killer cell immunoglobulin-like receptor 2DL5 with systemic lupus erythematosus and accompanying infections.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20230527 2010 The profile of KIR3DL1 and KIR3DS1 alleles in an African American population resembles that found in African populations.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20207982 2010 Natural killer-cell receptor polymorphisms and posttransplantation non-Hodgkin lymphoma.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20137308 2009 [Relationship between CMV reactivation and KIR haplotype/HLA-Cw genotype in patients after unrelated-donor hematopoietic stem cell transplantation.].
20131260 2010 Association of the KIR3DS1*013 and KIR3DL1*004 alleles with susceptibility to ankylosing spondylitis.
20124216 2010 Donor activating KIR3DS1 is associated with decreased acute GVHD in unrelated allogeneic hematopoietic stem cell transplantation.
20082646 2010 Killer cell immunoglobulin-like receptor gene diversity in a Caucasian population of southern Brazil.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19926642 2010 Disparate distribution of activating and inhibitory killer cell immunoglobulin-like receptor genes in patients with systemic lupus erythematosus.
19897003 2010 Killer cell immunoglobulin-like receptor gene-cluster 3DS1-2DL5-2DS1-2DS5 predisposes susceptibility to Vogt-Koyanagi-Harada syndrome in Japanese individuals.
19875891 2009 Frequencies of killer immunoglobulin-like receptor genotypes influence susceptibility to spontaneous abortion.
19874556 2010 No association of KIR3DL1 or KIR3DS1 or their alleles with ankylosing spondylitis.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19859704 2009 KIR3DL1/S1 genotypes and KIR2DS4 allelic variants in the AB KIR genotypes are associated with Plasmodium-positive individuals in malaria infection.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19664392 2009 [Genotype analysis of killer cell immunoglobulin-like receptors in Graves' disease patients].
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19527230 2009 Activating killer cell immunoglobulin-like receptor genes' association with recurrent miscarriage.
19522772 2009 High-throughput genotyping of KIR2DL2/L3, KIR3DL1/S1, and their HLA class I ligands using real-time PCR.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19489269 2009 [Genotype and haplotype analysis of killer cell immunoglobulin-like receptors in ankylosing spondylitis].
19454667 2009 Phenotypic and functional analyses of KIR3DL1+ and KIR3DS1+ NK cell subsets demonstrate differential regulation by Bw4 molecules and induced KIR3DS1 expression on stimulated NK cells.
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19421224 2009 Multiple sclerosis associates with LILRA3 deletion in Spanish patients.
19411600 2009 Meiotic recombination generates rich diversity in NK cell receptor genes, alleles, and haplotypes.
19386717 2009 HLA class I subtype-dependent expansion of KIR3DS1+ and KIR3DL1+ NK cells during acute human immunodeficiency virus type 1 infection.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19309280 2009 Distribution of killer cell immunoglobulin-like receptor (KIR) genotypes in patients with familial Mediterranean fever.
19279038 2009 Influence of activating and inhibitory killer immunoglobulin-like receptors on predisposition to recurrent miscarriages.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19211742 2009 Role of natural killer cells in a cohort of elite suppressors: low frequency of the protective KIR3DS1 allele and limited inhibition of human immunodeficiency virus type 1 replication in vitro.
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
19019897 2009 Analysis of killer immunoglobulin-like receptor genes in ankylosing spondylitis.
19008943 2008 Genetic control of variegated KIR gene expression: polymorphisms of the bi-directional KIR3DL1 promoter are associated with distinct frequencies of gene expression.
19000141 2009 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Java, Kalimantan, Timor and Irian Jaya.
18945962 2009 Donors with group B KIR haplotypes improve relapse-free survival after unrelated hematopoietic cell transplantation for acute myelogenous leukemia.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of ParanĂ¡.
18830515 2008 Natural killer cells and immune surveillance.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18687225 2008 [Study on the polymorphism of killer cell immunoglobulin like receptor (KIR) gene with systemic lupus erythematosus of North population in China].
18668235 2008 Asian population frequencies and haplotype distribution of killer cell immunoglobulin-like receptor (KIR) genes among Chinese, Malay, and Indian in Singapore.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18638658 2008 Activating KIR genes are associated with ankylosing spondylitis in Asian populations.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18351333 2008 Comparison of the rapidly evolving KIR locus in Parsis and natives of India.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18331531 2008 Investigation of killer cell immunoglobulin-like receptor gene diversity in KIR3DL1 and KIR3DS1 in a transplant population.
18317000 2008 Increased proportion of KIR3DS1 homozygotes in HIV-exposed uninfected individuals.
18305035 2008 Conferral of enhanced natural killer cell function by KIR3DS1 in early human immunodeficiency virus type 1 infection.
18297378 2008 Polymorphisms of KIRs gene and HLA-C alleles in patients with ankylosing spondylitis: possible association with susceptibility to the disease.
18074414 2007 Polymorphisms of killer cell immunoglobulin-like receptor gene: possible association with susceptibility to or clearance of hepatitis B virus infection in Chinese Han population.
18025129 2007 Differential natural killer cell-mediated inhibition of HIV-1 replication based on distinct KIR/HLA subtypes.
17997746 2007 Association of killer cell immunoglobulin-like receptor genotypes with susceptibility to endometriosis.
17990989 2007 Killer cell immunoglobulin-like receptor genotypes in Japanese patients with type 1 diabetes.
17882223 2007 Associations of killer cell immunoglobulin-like receptor genes with complications of rheumatoid arthritis.
17868255 2007 No association of KIR genes with Behcet's disease.
17694054 2007 Unusual selection on the KIR3DL1/S1 natural killer cell receptor in Africans.
17687550 2007 A mutation in KIR3DS1 that results in truncation and lack of cell surface expression.
17646980 2007 Chain-terminating natural mutations affect the function of activating KIR receptors 3DS1 and 2DS3.
17641029 2007 Detection of KIR3DS1 on the cell surface of peripheral blood NK cells facilitates identification of a novel null allele and assessment of KIR3DS1 expression during HIV-1 infection.
17592337 2007 Killer immunoglobulin-like receptor genotype may distinguish immunodeficient HIV-infected patients resistant to immune restoration diseases associated with herpes virus infections.
17490516 2007 [Polymorphism of killer cell immunoglobulin-like receptor gene and its correlation with leukemia].
17301953 2007 Allelic expression patterns of KIR3DS1 and 3DL1 using the Z27 and DX9 antibodies.
17202323 2007 Cutting Edge: KIR3DS1, a gene implicated in resistance to progression to AIDS, encodes a DAP12-associated receptor expressed on NK cells that triggers NK cell activation.
17200871 2007 KIR haplotype content at the allele level in 77 Northern Irish families.
17182560 2007 Functional polymorphism of the KIR3DL1/S1 receptor on human NK cells.
16805919 2006 Contribution of KIR3DL1/3DS1 to ankylosing spondylitis in human leukocyte antigen-B27 Caucasian populations.
16698433 Killer cell immunoglobulin-like receptor (KIR) genes in the Basque population: association study of KIR gene contents with type 1 diabetes mellitus.
16698429 KIR gene in ethnic and Mestizo populations from Mexico.
16508981 2006 Association of killer cell immunoglobulin-like receptor genotypes with microscopic polyangiitis.
15942906 2005 Protective effect of the HLA-Bw4I80 epitope and the killer cell immunoglobulin-like receptor 3DS1 gene against the development of hepatocellular carcinoma in patients with hepatitis C virus infection.
15896204 2005 Distribution of killer cell immunoglobulin-like receptor genes in the Chinese Han population.
15580659 2005 The silent KIR3DP1 gene (CD158c) is transcribed and might encode a secreted receptor in a minority of humans, in whom the KIR3DP1, KIR2DL4 and KIR3DL1/KIR3DS1 genes are duplicated.
12826375 2003 Multiple copies of KIR 3DL/S1 and KIR 2DL4 genes identified in a number of individuals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12134147 2002 Epistatic interaction between KIR3DS1 and HLA-B delays the progression to AIDS.
11859120 2002 Allelic polymorphism synergizes with variable gene content to individualize human KIR genotype.
11513141 2001 The genomic context of natural killer receptor extended gene families.
11098931 2000 Development of a PCR-SSOP approach capable of defining the natural killer cell inhibitory receptor (KIR) gene sequence repertoires.
10781084 2000 Plasticity in the organization and sequences of human KIR/ILT gene families.
9430221 1997 Human diversity in killer cell inhibitory receptor genes.
9430220 1997 Functionally and structurally distinct NK cell receptor repertoires in the peripheral blood of two human donors.
9059894 1997 Polymorphism and domain variability of human killer cell inhibitory receptors.
8662091 1996 Alternatively spliced forms of human killer inhibitory receptors.