Property Summary

NCBI Gene PubMed Count 190
PubMed Score 198.84
PubTator Score 216.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer -1.200 1.5e-02
diabetes mellitus 1.400 1.1e-03
pancreatic carcinoma -1.200 1.5e-02

Gene RIF (188)

PMID Text
26439909 Using depletion studies and Killer immunoglobulin-like receptors-transfected cell lines, demonstrated that the dengue virus NS1 tetramer bound the inhibitory receptor KIR3DL1.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking
26238044 KIR3DL1 has a protective effect against the more severe manifestations of ankylosing spondylitis.
25940819 In early axial spondyloarthritis and ankylosing spondylitis Dutch patients, no copy number changes were found for KIR3DL1.
25503311 Study shows KIR3DL1 and KIR2DS4 gene variants are linked and that the gene KIR2DS5 is only present in the telomeric half of the KIR locus. Study revealed novel insights in the highly organized distribution of KIR genes.
25480565 the strict conformation of HLA-Bw4 allotypes, held in place by the Glu(76)-Arg(83) interaction, facilitates KIR3DL1 binding, whereas Bw6 allotypes present a platform on the alpha1 helix that is less permissive for KIR3DL1 binding.
25330014 Individuals who carried both KIR3DS1 and Bw4*80I did not remain HIV seronegative longer than those from a control group who were homozygous for HLA-Bw6 and carried no HLA-A locus Bw4 alleles
25320293 KIR3DL1+ NK cells can partially overcome inhibition to exhibit anti-HIV-1 Ab-dependent activation of NK cells, leading to suppress target cells presenting to HIV-1 gp120
25139336 Characterizing Maori and Polynesians is a paucity of HLA-B allotypes recognized by KIR.
25112829 Protective genotypes in HIV infection reflect superior function of KIR3DS1 over KIR3DL1-expressing CD8+ T cells.
24929144 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C patients.
24755352 The frequency of KIR3DL1 with HLA-Bw4 was significantly lower in diffuse large B-cell lymphoma patients than in controls.
24563253 Data indicate the impact of KIR3DL1 polymorphism on peptide-laden HLA recognition.
24453969 HIV protective KIR3DL1/S1-HLA-B genotypes influence NK cell-mediated inhibition of HIV replication in autologous CD4 targets.
24367901 The results of this study found that specific combinations of KIR and their HLA ligands can be either risk factors or protective for immune responses triggering Guillain-Barre Syndrome.
24349500 combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene are predictive of the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV.
24173144 KIR3DL1 genetic diversity in the Chinese Han population and it's mRNA expression pattern
24059286 Different KIR3DS1, KIR3DL1 and HLA-Bw4 genotypes and levels of transcripts associate with HIV disease progression.
23984333 HLA-B alleles carrying Bw4 epitope present the highest capability of interaction with KIR3DL1 *001 compared to the HLA-B alleles presenting Bw6.
23524032 Report reliable and accurate method for genotyping KIR3DL1/S1 using DNA recovered from plasma.
23436464 Both the nature of KIR3DL1 alleles and the KIR3DL1/S1 allele combination affect the KIR3DL1 NK-cell repertoire in the French population.
23354323 Data indicate that positive linkage disequilibrium was observed between KIR3DL1, 2DL1, 2DL3 and 2DS4 which is consistent with the associations between the constituents of A haplotypes.
23328843 present work has shown that IL-2 and IL-15, cytokines critical for NK cell development and maintenance, greatly stimulate KIR3DL1 reverse promoter activity, but not forward promoter activity
23266622 Our data suggest a possible association of KIR/HLA variants and the severity of Gaucher disease.
22842045 results show that immunogenetic factors, such as the KIR gene profile, can play a role in tyrosine kinase inhibitor therapy response
22803950 Increased matching between expressed KIR-3DL1 and its ligand HLA-Bw4 was found in Italian patients with paroxysmal nocturnal haemoglobinuria.
22020283 structure of a human KIR3DL1 receptor bound to HLA-B*5701 complexed with a self-peptide
21797986 In this study, KIR2DS1+HLA-C2 and KIR3DL1+HLA-B Bw4 Ile80 combinations were associated with the vulnerability to ankylosing spondylitis.
21746965 The first Ig domain of KIR3DL1 contacts MHC class I at a secondary site.
21726204 the pattern of inhibitory/activating KIR genes, together with their HLA ligands, is associated with susceptibility to B-cell chronic lymphocytic leukemia and affects the clinical course of this disease
21696085 It was observed that the Thai population shows polymorphism of the KIR genes and the diversities of KIR genes in Thai differed from other populations.
21690332 In this review, KIR3DL1/S1 is described as the most extensively studied of the variable natural killer (NK) cell receptors, exemplifying how variation in all possible parameters of function is recruited to diversify the human NK cell response.
21616111 KIR3DL1 gene expression is upregulated in intestinal mucosa in active celiac disease.
21471246 Distinct HIV-1 epitopes differentially modulated the binding of KIR3DL1 to HLA-Bw4.
21471235 Enhanced NK polyfunctionality in HIV slow progressors was dependent upon the coexpression of both KIR3DL1*h/*y and HLA-B*57.
21206914 analysis of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus
21115737 Natural killer (NK) cell receptor KIR3DL1*004 is sequestered in the endoplasmic reticulum of the NK cell where it binds to the chaperone calreticulin and does not induce the unfolded protein response.
20935224 Observational study of gene-disease association. (HuGE Navigator)
20887224 Despite its ability to license NK cells, KIR3DL1*004/HLA-Bw4 is not associated with a reduced risk of HIV infection.
20887224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20878400 Observational study of gene-disease association. (HuGE Navigator)
20818412 This finding indicates that the inhibitory KIR3DL1 receptor protects against the development of ankylosing spondylitis and is not simply a passive counterpart of the segregating KIR3DS1 allele encoding the activating receptor.
20818412 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20664023 Results indicate a prominent role for KIR3DL1/HLA-Bw4 interactions in licensing natural killer cells for CD16-mediated effector function.
20652381 genetic polymorphism contributes to pathogenesis of ankylosing spondylitis
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20631304 Results show that antisense transcripts mediate KIR transcriptional silencing through a novel PIWI-like 28-base small RNA.
20600442 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20574122 expression levels of KIR3DL1 may be involved in the pathogenesis of ankylosing spondylitis
20528243 Killer cell immunoglobulin-like receptor gene polymorphism may be associated with lymphoproliferative diseases of granular lymphocytes.
20528243 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20371502 Observational study of gene-disease association. (HuGE Navigator)
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20230527 KIR3DL1 and KIR3DS1 allele frequencies were determined by DNA sequencing of the complete coding regions from 100 random unrelated African Americans
20230527 Observational study of genotype prevalence. (HuGE Navigator)
20210921 a novel KIR3DL1*072 allele
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20207982 Observational study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20137308 Observational study of gene-disease association. (HuGE Navigator)
20131260 Allotypes such as KIR3DL1*004 demonstrate a negative association in patients with ankylosing spondylitis in the presence of HLA-Bw4I80.
20082646 Observational study of genotype prevalence. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
20061407 Natural killer (NK) cells from individuals with the genotype KIR3DL1*h/*y/HLA-B*57 combination are associated with the control of human immunodeficiency virus (HIV), particularly in the KIR3DL1-positive NK cell subset.
19968064 Observational study of gene-disease association. (HuGE Navigator)
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19926642 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19897003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19875891 Observational study of gene-disease association. (HuGE Navigator)
19874556 no association in frequencies of the alleles of these gene in ankylosing spondylitis
19874556 Observational study of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19859704 Data revealed that the trend of parasitic positive individuals to be KIR3DL1/KIR3DS1 heterozygous in pair with KIR2DS4 nondeleted variants in a set of KIR genes inheritable as the AB genotypes.
19859704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19761533 Observational study of gene-disease association. (HuGE Navigator)
19752231 Substitutions at positions 163, 166, and 199 of KIR3DL1 abrogate HLA-A24nef binding, but not the binding of anti-3DL1 antibodies.
19683555 Observational study of gene-disease association. (HuGE Navigator)
19675166 Antibody cross-linking of inhibitory receptor KIR3DL1 prevents the autoreactive macrophage killing that characterizes lupus T cells.
19664392 Genotypes without activating KIR genes have higher frequency in patient group.
19664392 Observational study of gene-disease association. (HuGE Navigator)
19630074 Carriage of the ligand of inhibitory KIR3DL1 receptor HLA-Bw4 is found to protect against mltiple sclerosis in an HLA-DRB1 independent manner.
19630074 Observational study of gene-disease association. (HuGE Navigator)
19549379 The less the KIR/HLA-Cw matched, the more cytotoxic activity was shown in NK cells.
19527230 Observational study of gene-disease association. (HuGE Navigator)
19522772 Observational study of genetic testing. (HuGE Navigator)
19493232 Observational study of gene-disease association. (HuGE Navigator)
19489269 Observational study of gene-disease association. (HuGE Navigator)
19450876 Observational study of gene-disease association. (HuGE Navigator)
19421224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19411600 Studied here is KIR3DL1/S1, which encodes receptors for highly polymorphic human HLA-A and -B and comprises three ancient allelic lineages that have been preserved by balancing selection throughout human evolution
19386717 Persistence of KIR3DS1+ and KIR3DL1+ NK cells during acute HIV1 infection is HLA class I-dependent.
19326408 Observational study of gene-disease association. (HuGE Navigator)
19309280 Observational study of gene-disease association. (HuGE Navigator)
19279038 Observational study of gene-disease association. (HuGE Navigator)
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19211742 Observational study of gene-disease association. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19176033 E2F1 participates in the regulation of the transcriptional activation of the KIR3DL1 gene.
19169284 To assess whether KIR ligands, KIR genes and KIR haplotypes are associated with HSCT outcome of 124 patients with various hematological malignancies, transplanted with 12/12 HLA matched grafts from unrelated donors.
19169284 Observational study of gene-disease association. (HuGE Navigator)
19151793 The quantity of HLA-I expression on precursor-B-ALL blast regulates overall NK cell susceptibility; in case of reduced HLA expression, differential surface expression of killer cell Ig-like receptor affects NK cell alloreactivity against those blasts.
19120281 Observational study of gene-disease association. (HuGE Navigator)
19118512 The aim of this study was to explore the possibility of the inheritance of KIR genotypes and haplotypes as a candidate for susceptibility to persistent hepatitis B virus (HBV) infection or HBV clearance.
19116110 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19046302 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19032228 KIR/HLA genotype and expression of NKG2C and NKG2D might play a significant role in regulating natural killer cell function and anti-cytomegalovirus immunity after kidney transplantation.
19032228 Observational study of gene-disease association. (HuGE Navigator)
19019897 Observational study of gene-disease association. (HuGE Navigator)
19008943 The frequency of KIR3DL1/S1 subtype expression on NK cells contribute to the phenotypic variation across allotypes with respect to disease resistance.
19000148 Our data suggest that extensive KIR gene polymorphisms are ubiquitous as well as quite complex.
19000141 Observational study of genotype prevalence. (HuGE Navigator)
18945962 Observational study of gene-disease association. (HuGE Navigator)
18941220 Polymorphism at sites throughout the human leukocyte antigen (HLA) class I molecule can influence the interaction of the HLA Bw4 epitope with KIR3DL1.
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18830515 Observational study of genotype prevalence. (HuGE Navigator)
18800608 plays a role in the regulation of GVHD and GVL. (review)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18718052 Observational study of gene-disease association. (HuGE Navigator)
18687225 There may be a association between the polymorphism of KIR genes with systemic lupus erythematosus in North of China.
18687225 Observational study of gene-disease association. (HuGE Navigator)
18668235 Observational study of genotype prevalence. (HuGE Navigator)
18643961 Observational study of gene-disease association. (HuGE Navigator)
18638658 3DL1/3DS1 demonstrated an increased frequency in ankylosing spondylitis (p(c) < 0.005 in the Chinese population and p(c) < 0.05 in the Thai population)
18632158 Genetic interactions of KIR and G1M immunoglobulin allotypes differ in obese and non-obese individuals with type 2 diabetes.
18614872 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18549610 kir3dl1 expression in K562 cells is regulated by DNA methylation.
18515573 The HLA-Cw*0701 allele and KIR haplotype AA are associated with AMD. This genotype combination suggests that natural killer cells have a role in the pathogenesis of AMD.
18502829 expression of HLA A*2301, A*2402, or A*3201 but not HLA A*2501 protects target cells from lysis by KIR3DL1(+) NK cells
18453594 KIR3DL1 evolution maintains variation in KIR3DL1 cell-surface expression levels, potentially due to the effect of such variation on functional capacity.
18385451 analysis of the ability of most common HLA-B alleles and HLA-A alleles with Bw4 serologic reactivity to protect target cells from lysis by KIR3DL1-dependent NK cells
18358829 E2F1 contributes to the transcriptional activation of the KIR3DL1 gene.
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18331531 in bone marrow transplant patients alleles 3DL1*00101 & *002 were most frequently observed in addition to 12 other known 3DL1 alleles; A single 3DS1 allele, 3DS1*01301, was identified; two new alleles, 3DL1*01702 and 3DS1*058, were characterized
18331531 Observational study of gene-disease association. (HuGE Navigator)
18301382 various sequence motifs are implicated in the PKC-mediated post-transcriptional upregulation of KIR, and each of these motifs work in different steps after PKC activation
18269867 Observational study of gene-disease association. (HuGE Navigator)
18186800 Observational study of genotype prevalence. (HuGE Navigator)
17990989 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17950922 KIR donor-recipient genotype is not predictive for the outcome of unrelated-donor hematopoietic stem cell tranplantation in patients with beta-Thalassemia.
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17714418 Maternal KIR/fetal HLA-Cw gene combinations that are involved in the fetomaternal tolerance do not appear to play a role in the HPA-1a alloimmunization.
17694054 KIR3DL1/S1 is under balancing selection in most human populations except Africans. KIR3DL1/S1 is co-evolving with Bw4 ligand of HLA-A and B.
17498266 Observational study of genotype prevalence. (HuGE Navigator)
17493145 Observational study of gene-disease association. (HuGE Navigator)
17490516 Observational study of gene-disease association. (HuGE Navigator)
17462498 Observational study of gene-disease association. (HuGE Navigator)
17385087 This report is comparing KIR genotyping distribution in two Arab populations that sheds additional light on the importance of this gene in delineating a possible geographic genetic demarcation among different ethnicities.
17383044 Frequency of HLA-Bw4 and -C2, which are ligands for the inhibitory KIRs 3DL1 and 2DL1, respectively, was significantly reduced in Primary sclerosing cholangitis patients as compared with controls
17301953 In 3DS1/3DL1 heterozygous donors significant numbers of natural killer (NK) cells express 3DS1 without co-expressing 3DL1 and that NK cells expressing both alleles are difficult to detect.
17202323 KIR3DS1 associates with the ITAM-bearing adaptor, DAP12
17200871 Observational study of genotype prevalence. (HuGE Navigator)
17182560 Inhibitory alleles of KIR3DL1 differ in their ability to recognize HLA-Bw4 ligand, and a consistent hierarchy of ligand reactivity can be defined.
17182537 This study shows that HLA-A*2402 is a ligand for KIR3DL1 and demonstrates how the binding of KIR3DL1 to Bw4(+) ligands depends upon the bound peptide as well as HLA and KIR3DL1 polymorphism.
16818466 We took a comprehensive linker-scanning mutagenesis approach and substituted 24 consecutive 10-bp segments in the human KIR3DL1 promoter. Our analysis revealed eight segments that activated and three segments that repressed KIR transcription.
16805919 Observational study of gene-disease association. (HuGE Navigator)
16805919 Presence of KIR3DS1 or KIR3DL1 in combination with HLA-B*27s/HLA-B Bw4-I80 genotypes may modulate the development of ankylosing spondylitis.
16508981 Observational study of gene-disease association. (HuGE Navigator)
16403292 Observational study of genotype prevalence. (HuGE Navigator)
16210627 KIR3DL1 allotypes contribute to development of an inhibitory response to HLA-Bw4 ligands in transduced natural killer (NK) leukemia cell lines.
15942906 The human leukocyte antigen-Bw4I80 epitope and the KIR3DS1 gene were more frequent in HCV carriers than in patients with hepatocellular carcinoma, and the associations were not independent of each other.
15896204 Observational study of genotype prevalence. (HuGE Navigator)
15784466 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15730517 Observational study of gene-disease association. (HuGE Navigator)
15580659 4.5% of the individuals of a Caucasoid population bear a recombinant allele of KIR3DP1, officially designed KIR3DP1*004, that associates tightly with gene duplications of KIR3DP1, KIR2DL4 and KIR3DL1/KIR3DS1
15217996 Decreased expression of NKB1 and GL183 on natural killer (NK) cells in endometrium, but not in myometrium, in women with adenomyosis. May be compensatory effect in which NK cytotoxicity is activated in order to eradicate abnormal endometrial cells.
14662867 Analysis of recombinant mutants made between KIR3DL1*004 and KIR3DL1*002 alleles shows that polymorphism in immunoglobulin domains 0 and 1 causes intracellular retention of KIR3DL1*004, preventing cell surface expression and function.
12826375 isolated 3 distinct KIR2DL4 allele clones in each individual with multiple copies of KIR3DL/S1; assumption that unequal crossover event occurred between differing KIR haplotypes resulting in the duplication of the 2DL4, 3DS1/3DL1 genes
12794136 The promoter of KIR3DL1 exhibits variegated expression in a range of cell types, with reduced activity suggesting a requirement for other regulatory elements for physiological expression compared to the KIR2DL4 promoter.
12559621 Positive linkage disequilibrium was seen between KIR3DS1 and KIR2DS3, and between KIR3DS1 and KIR2DS5.
12538663 Allele-specific 3DL1 gene expression correlated with promoter and 5' gene DNA hypomethylation in NK cells in vitro and in vivo.
12244166 KIR inhibits activation-induced cell death by blocking Fas ligand induction upon stimulation in a process apparently accomplished by protein kinase C (PKC) recruitment to the membrane-proximal PKC binding site and subsequent inhibition of PKC activation.
11904677 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPI      1 - 70
FHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERV     71 - 140
ILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPS    141 - 210
DPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVII    281 - 350
LFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT    351 - 420
PPTDTILYTELPNAKPRSKVVSCP                                                  421 - 444
//

Text Mined References (191)

PMID Year Title
26439909 2016 Interaction of a dengue virus NS1-derived peptide with the inhibitory receptor KIR3DL1 on natural killer cells.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking.
26238044 2015 Study on the protective effect of the KIR3DL1 gene in ankylosing spondylitis.
25940819 2015 KIR3DL1 and KIR3DL2 gene copy number variation in axial spondyloarthritis.
25503311 2015 Novel insights in the genomic organization and hotspots of recombination in the human KIR locus through analysis of intergenic regions.
25480565 2015 The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope.
25330014 2014 Time to seroconversion in HIV-exposed subjects carrying protective versus non protective KIR3DS1/L1 and HLA-B genotypes.
25139336 2014 KIR diversity in M?ori and Polynesians: populations in which HLA-B is not a significant KIR ligand.
25112829 2015 Protective genotypes in HIV infection reflect superior function of KIR3DS1+ over KIR3DL1+ CD8+ T cells.
24929144 2014 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C.
24755352 2014 Killer cell immunoglobulin-like receptors in Thai patients with leukemia and diffuse large B-cell lymphoma.
24563253 2014 Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity.
24453969 2014 HIV protective KIR3DL1/S1-HLA-B genotypes influence NK cell-mediated inhibition of HIV replication in autologous CD4 targets.
24367901 2014 Killer immunoglobulin-like receptor and their HLA ligands in Guillain-Barré Syndrome.
24349500 2013 KIR, HLA, and IL28B variant predict response to antiviral therapy in genotype 1 chronic hepatitis C patients in Japan.
24173144 2014 KIR3DL1 genetic diversity and phenotypic variation in the Chinese Han population.
24059286 2013 KIR3DS1/L1 and HLA-Bw4-80I are associated with HIV disease progression among HIV typical progressors and long-term nonprogressors.
23984333 2013 Immunoinformatic docking approach for the analysis of KIR3DL1/HLA-B interaction.
23524032 2013 A method for killer-cell immunoglobulin-like receptor (KIR) 3DL1/3DS1 genotyping using DNA recovered from frozen plasma.
23436464 2013 Both the nature of KIR3DL1 alleles and the KIR3DL1/S1 allele combination affect the KIR3DL1 NK-cell repertoire in the French population.
23354323 2013 Study of the KIR gene profiles and analysis of the phylogenetic relationships of Rajbanshi population of West Bengal, India.
23328843 2013 IL-2/IL-15 activate the human clonally restricted KIR3DL1 reverse promoter.
23266622 2013 KIR genes and HLA class I ligands in Gaucher disease.
22842045 2012 Killer-cell immunoglobulin-like receptor gene profile predicts good molecular response to dasatinib therapy in chronic myeloid leukemia.
22803950 2012 Killer immunoglobulin-like receptors (KIR) and their HLA-ligands in Italian paroxysmal nocturnal haemoglobinuria (PNH) patients.
22020283 2011 Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B.
21797986 2011 KIR3DL1+HLA-B Bw4Ile80 and KIR2DS1+HLA-C2 combinations are both associated with ankylosing spondylitis in the Iranian population.
21746965 2011 The first Ig domain of KIR3DL1 contacts MHC class I at a secondary site.
21726204 2011 KIR/HLA gene combinations influence susceptibility to B-cell chronic lymphocytic leukemia and the clinical course of disease.
21696085 2011 Distribution of killer cell immunoglobulin-like receptor genes in Thai blood donors.
21690332 2011 Variable NK cell receptors exemplified by human KIR3DL1/S1.
21616111 2011 Upregulation of KIR3DL1 gene expression in intestinal mucosa in active celiac disease.
21471246 2011 Common HIV-1 peptide variants mediate differential binding of KIR3DL1 to HLA-Bw4 molecules.
21471235 2011 Receptor-ligand requirements for increased NK cell polyfunctional potential in slow progressors infected with HIV-1 coexpressing KIR3DL1*h/*y and HLA-B*57.
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
21115737 2011 Interactions of NK cell receptor KIR3DL1*004 with chaperones and conformation-specific antibody reveal a functional folded state as well as predominant intracellular retention.
20935224 2010 Genotypes of NK cell KIR receptors, their ligands, and Fc? receptors in the response of neuroblastoma patients to Hu14.18-IL2 immunotherapy.
20887224 2010 Mind the gap: lack of association between KIR3DL1*004/HLA?Bw4-induced natural killer cell function and protection from HIV infection.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20818412 2010 Contribution of functional KIR3DL1 to ankylosing spondylitis.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20664023 2010 Killer cell immunoglobulin-like receptor 3DL1 licenses CD16-mediated effector functions of natural killer cells.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20631304 2010 Cutting edge: KIR antisense transcripts are processed into a 28-base PIWI-like RNA in human NK cells.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20574122 2010 Inhibitory killer cell immunoglobulin-like receptor KIR3DL1 in combination with HLA-B Bw4iso protect against ankylosing spondylitis.
20528243 2010 Killer cell immunoglobulin-like receptor gene polymorphism in lymphoproliferative diseases of granular lymphocytes in a Japanese population.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20371502 2010 Association of killer cell immunoglobulin-like receptor 2DL5 with systemic lupus erythematosus and accompanying infections.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20230527 2010 The profile of KIR3DL1 and KIR3DS1 alleles in an African American population resembles that found in African populations.
20210921 2010 Identification of a novel KIR3DL1*072 allele by sequence-based typing.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20207982 2010 Natural killer-cell receptor polymorphisms and posttransplantation non-Hodgkin lymphoma.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20137308 2009 [Relationship between CMV reactivation and KIR haplotype/HLA-Cw genotype in patients after unrelated-donor hematopoietic stem cell transplantation.].
20131260 2010 Association of the KIR3DS1*013 and KIR3DL1*004 alleles with susceptibility to ankylosing spondylitis.
20082646 2010 Killer cell immunoglobulin-like receptor gene diversity in a Caucasian population of southern Brazil.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
20061407 2010 HIV protective KIR3DL1 and HLA-B genotypes influence NK cell function following stimulation with HLA-devoid cells.
20028428 2010 The extensive polymorphism of KIR genes.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19926642 2010 Disparate distribution of activating and inhibitory killer cell immunoglobulin-like receptor genes in patients with systemic lupus erythematosus.
19897003 2010 Killer cell immunoglobulin-like receptor gene-cluster 3DS1-2DL5-2DS1-2DS5 predisposes susceptibility to Vogt-Koyanagi-Harada syndrome in Japanese individuals.
19875891 2009 Frequencies of killer immunoglobulin-like receptor genotypes influence susceptibility to spontaneous abortion.
19874556 2010 No association of KIR3DL1 or KIR3DS1 or their alleles with ankylosing spondylitis.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19859704 2009 KIR3DL1/S1 genotypes and KIR2DS4 allelic variants in the AB KIR genotypes are associated with Plasmodium-positive individuals in malaria infection.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19752231 2009 Dimorphic motifs in D0 and D1+D2 domains of killer cell Ig-like receptor 3DL1 combine to form receptors with high, moderate, and no avidity for the complex of a peptide derived from HIV and HLA-A*2402.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19675166 2009 Stimulatory and inhibitory killer Ig-like receptor molecules are expressed and functional on lupus T cells.
19664392 2009 [Genotype analysis of killer cell immunoglobulin-like receptors in Graves' disease patients].
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19549379 2009 [Gene KIR in match with HLA-Cw impacts on NK cell cytotoxicity].
19527230 2009 Activating killer cell immunoglobulin-like receptor genes' association with recurrent miscarriage.
19522772 2009 High-throughput genotyping of KIR2DL2/L3, KIR3DL1/S1, and their HLA class I ligands using real-time PCR.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19489269 2009 [Genotype and haplotype analysis of killer cell immunoglobulin-like receptors in ankylosing spondylitis].
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19421224 2009 Multiple sclerosis associates with LILRA3 deletion in Spanish patients.
19411600 2009 Meiotic recombination generates rich diversity in NK cell receptor genes, alleles, and haplotypes.
19386717 2009 HLA class I subtype-dependent expansion of KIR3DS1+ and KIR3DL1+ NK cells during acute human immunodeficiency virus type 1 infection.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19309280 2009 Distribution of killer cell immunoglobulin-like receptor (KIR) genotypes in patients with familial Mediterranean fever.
19279038 2009 Influence of activating and inhibitory killer immunoglobulin-like receptors on predisposition to recurrent miscarriages.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19211742 2009 Role of natural killer cells in a cohort of elite suppressors: low frequency of the protective KIR3DS1 allele and limited inhibition of human immunodeficiency virus type 1 replication in vitro.
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19176033 2008 [Molecular regulation of KIR3DL1 gene expression by transcription factor E2F1].
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19151793 2009 Cytolytic activity of NK cell clones against acute childhood precursor-B-cell leukaemia is influenced by HLA class I expression on blasts and the differential KIR phenotype of NK clones.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19118512 2008 Association of KIR genotypes and haplotypes with susceptibility to chronic hepatitis B virus infection in Chinese Han population.
19116110 2008 [Carrying certain KIR3DL1 alleles with HLA-B*57 is associated with protection from HIV infection].
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
19019897 2009 Analysis of killer immunoglobulin-like receptor genes in ankylosing spondylitis.
19008943 2008 Genetic control of variegated KIR gene expression: polymorphisms of the bi-directional KIR3DL1 promoter are associated with distinct frequencies of gene expression.
19000148 2008 Alleles and intron polymorphism of KIR3DL1 shown by combination of allele group-specific primers and sequencing.
19000141 2009 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Java, Kalimantan, Timor and Irian Jaya.
18945962 2009 Donors with group B KIR haplotypes improve relapse-free survival after unrelated hematopoietic cell transplantation for acute myelogenous leukemia.
18941220 2008 Polymorphic sites away from the Bw4 epitope that affect interaction of Bw4+ HLA-B with KIR3DL1.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of Paraná.
18830515 2008 Natural killer cells and immune surveillance.
18800608 2008 [Role of NK cell receptor-expressing cells in the regulation of GVHD and GVL].
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18718052 2008 [Differential expression levels of killer immunoglobin-like receptor genotype in patients with hematological malignancies between high-risk and standard-risk groups].
18687225 2008 [Study on the polymorphism of killer cell immunoglobulin like receptor (KIR) gene with systemic lupus erythematosus of North population in China].
18668235 2008 Asian population frequencies and haplotype distribution of killer cell immunoglobulin-like receptor (KIR) genes among Chinese, Malay, and Indian in Singapore.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18638658 2008 Activating KIR genes are associated with ankylosing spondylitis in Asian populations.
18632158 2008 Genetic interactions of KIR and G1M immunoglobulin allotypes differ in obese from non-obese individuals with type 2 diabetes.
18614872 2008 A combined genotype of KIR3DL1 high expressing alleles and HLA-B*57 is associated with a reduced risk of HIV infection.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18549610 2008 [DNA methylation regulates kir3dl1 gene expression in K562 cell line].
18515573 2008 Age-related macular degeneration is associated with the HLA-Cw*0701 Genotype and the natural killer cell receptor AA haplotype.
18502829 2008 Human leukocyte antigens A23, A24, and A32 but not A25 are ligands for KIR3DL1.
18453594 2008 Novel KIR3DL1 alleles and their expression levels on NK cells: convergent evolution of KIR3DL1 phenotype variation?
18385451 2008 The reactivity of Bw4+ HLA-B and HLA-A alleles with KIR3DL1: implications for patient and donor suitability for haploidentical stem cell transplantations.
18358829 2008 E2F1 contributes to the transcriptional activation of the KIR3DL1 gene.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18331531 2008 Investigation of killer cell immunoglobulin-like receptor gene diversity in KIR3DL1 and KIR3DS1 in a transplant population.
18301382 Amino-acid sequence motifs for PKC-mediated membrane trafficking of the inhibitory killer Ig-like receptor.
18269867 2007 [Distribution of immunoglobulin like receptor gene in Han population in China and the impact thereof on the HLA-identical sibling hematopoietic stem cell transplantation].
18186800 2008 Distribution of KIR genes in the Czech population.
17990989 2007 Killer cell immunoglobulin-like receptor genotypes in Japanese patients with type 1 diabetes.
17950922 2007 Status of donor-recipient HLA class I ligands and not the KIR genotype is predictive for the outcome of unrelated hematopoietic stem cell transplantation in beta-thalassemia patients.
17868255 2007 No association of KIR genes with Behcet's disease.
17714418 2007 The alloimmune response to the human platelet antigen-1a is not related to maternal-fetal killer immunoglobulinlike receptor/HLA-Cw combinations.
17694054 2007 Unusual selection on the KIR3DL1/S1 natural killer cell receptor in Africans.
17498266 2007 KIR genes polymorphism in Argentinean Caucasoid and Amerindian populations.
17493145 2007 Analysis of KIR gene frequencies in HLA class I characterised bladder, colorectal and laryngeal tumours.
17490516 2007 [Polymorphism of killer cell immunoglobulin-like receptor gene and its correlation with leukemia].
17462498 2007 Donor-recipient combinations of group A and B KIR haplotypes and HLA class I ligand affect the outcome of HLA-matched, sibling donor hematopoietic cell transplantation.
17385087 2008 Natural killer cell immunoglobulin-like receptors (KIR) genotypes in two arab populations: will KIR become a genetic landmark between nations?
17383044 2007 Particular genetic variants of ligands for natural killer cell receptors may contribute to the HLA associated risk of primary sclerosing cholangitis.
17301953 2007 Allelic expression patterns of KIR3DS1 and 3DL1 using the Z27 and DX9 antibodies.
17200871 2007 KIR haplotype content at the allele level in 77 Northern Irish families.
17182560 2007 Functional polymorphism of the KIR3DL1/S1 receptor on human NK cells.
17182537 2007 Cutting Edge: Allele-specific and peptide-dependent interactions between KIR3DL1 and HLA-A and HLA-B.
16818466 2006 Functional redundancy of transcription factor-binding sites in the killer cell Ig-like receptor (KIR) gene promoter.
16805919 2006 Contribution of KIR3DL1/3DS1 to ankylosing spondylitis in human leukocyte antigen-B27 Caucasian populations.
16508981 2006 Association of killer cell immunoglobulin-like receptor genotypes with microscopic polyangiitis.
16403292 2005 [Polymorphism of killer cell immunoglobulin-like receptors gene family in Zhejiang Han population].
16210627 2005 KIR3DL1 polymorphisms that affect NK cell inhibition by HLA-Bw4 ligand.
15896204 2005 Distribution of killer cell immunoglobulin-like receptor genes in the Chinese Han population.
15784466 2005 Interaction between KIR3DL1 and HLA-B*57 supertype alleles influences the progression of HIV-1 infection in a Zambian population.
15730517 2005 A population-based cohort study of KIR genes and genotypes in relation to cervical intraepithelial neoplasia.
15580659 2005 The silent KIR3DP1 gene (CD158c) is transcribed and might encode a secreted receptor in a minority of humans, in whom the KIR3DP1, KIR2DL4 and KIR3DL1/KIR3DS1 genes are duplicated.
15217996 2004 Decreased expression of killer cell inhibitory receptors on natural killer cells in eutopic endometrium in women with adenomyosis.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14662867 2003 The protein made from a common allele of KIR3DL1 (3DL1*004) is poorly expressed at cell surfaces due to substitution at positions 86 in Ig domain 0 and 182 in Ig domain 1.
14607943 2003 Activation of a subset of human NK cells upon contact with Plasmodium falciparum-infected erythrocytes.
12826375 2003 Multiple copies of KIR 3DL/S1 and KIR 2DL4 genes identified in a number of individuals.
12794136 2003 Different and divergent regulation of the KIR2DL4 and KIR3DL1 promoters.
12559621 2003 Assessment of killer cell immunoglobulinlike receptor expression and corresponding HLA class I phenotypes demonstrates heterogenous KIR expression independent of anticipated HLA class I ligands.
12538663 2003 DNA methylation maintains allele-specific KIR gene expression in human natural killer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244166 2002 Molecular mechanism of the activation-induced cell death inhibition mediated by a p70 inhibitory killer cell Ig-like receptor in Jurkat T cells.
11904677 2002 Distinctive KIR and HLA diversity in a panel of north Indian Hindus.
11859120 2002 Allelic polymorphism synergizes with variable gene content to individualize human KIR genotype.
11733001 2001 ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3).
11207248 2001 Different NK cell surface phenotypes defined by the DX9 antibody are due to KIR3DL1 gene polymorphism.
11098931 2000 Development of a PCR-SSOP approach capable of defining the natural killer cell inhibitory receptor (KIR) gene sequence repertoires.
10774747 2000 Diversity of the p70 killer cell inhibitory receptor (KIR3DL) family members in a single individual.
9894849 1998 Multiple transcripts of the killer cell immunoglobulin-like receptor family, KIR3DL1 (NKB1), are expressed by natural killer cells of a single individual.
9430221 1997 Human diversity in killer cell inhibitory receptor genes.
9430220 1997 Functionally and structurally distinct NK cell receptor repertoires in the peripheral blood of two human donors.
9059894 1997 Polymorphism and domain variability of human killer cell inhibitory receptors.
8777725 1995 Killer cell inhibitory receptors specific for HLA-C and HLA-B identified by direct binding and by functional transfer.
8760804 1996 The natural killer cell receptor specific for HLA-A allotypes: a novel member of the p58/p70 family of inhibitory receptors that is characterized by three immunoglobulin-like domains and is expressed as a 140-kD disulphide-linked dimer.
8662091 1996 Alternatively spliced forms of human killer inhibitory receptors.
8046332 1994 NKB1: a natural killer cell receptor involved in the recognition of polymorphic HLA-B molecules.
7749980 1995 Molecular clones of the p58 NK cell receptor reveal immunoglobulin-related molecules with diversity in both the extra- and intracellular domains.
7716543 1995 Cloning of immunoglobulin-superfamily members associated with HLA-C and HLA-B recognition by human natural killer cells.
7650366 1995 Molecular cloning of NKB1. A natural killer cell receptor for HLA-B allotypes.