Property Summary

NCBI Gene PubMed Count 119
PubMed Score 0.00
PubTator Score 57.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 3.2e-11
osteosarcoma 7933 2.4e-05
medulloblastoma, large-cell 6234 4.7e-04

Gene RIF (105)

PMID Text
26476204 Collectively, our data suggest that the KIR 2DS4/1D allelic variance is associated with the outcome of sibling-related HLA-matched HSCT, and that donor subclassification of KIR 2DS4/1D alleles should be considered in this setting.
26206121 genetic polymorphism is associated with the course of Hepatitis C virus infection and the response to therapy
26031759 genetic association study in population in Eastern India: Data suggest that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) contribute significantly toward susceptibility and protection toward type 1 diabetes.
25961063 KIR2DS4 can induce the uptake of CCR7 by KIR2DS4(+) NKG2A(+) natural killer cell clones after interacting with CCR7(+) target cells expressing HLA-Cw4 and HLA-Cw6 alleles.
25724317 KIR2DS4del presence in patients was associated with severity of endometriosis, which, due to strong negative linkage disequilibrium, may suggest an indirect effect of KIR2DS5 absence
25715101 These results highlight the impact of population allele frequency on viral control and identify a novel association between HLA-C04 : 01 in combination with KIR2DS4f and uncontrolled HIV infection.
25503311 Study shows KIR3DL1 and KIR2DS4 gene variants are linked and that the gene KIR2DS5 is only present in the telomeric half of the KIR locus. Study revealed novel insights in the highly organized distribution of KIR genes.
25069714 Response of rheumatoid arthritis patients with medium ESR values to methotrexate treatment may be dependent on the full-length KIR2DS4 gene.
24239756 Possession of the functional and non-functional KIR2DS4 isoforms in the mother and the fetus determines the risk of the vertical HIV-1 transmission.
24112428 lower genotype frequency in children with systemic juvenile idiopathic arthritis
23354323 Data indicate that positive linkage disequilibrium was observed between KIR3DL1, 2DL1, 2DL3 and 2DS4 which is consistent with the associations between the constituents of A haplotypes.
23325834 Our data revealed a unique contribution of activating KIRs (KIR2DS4, KIR2DS2, or KIR3DS1), in addition to NKG2C, in the expansion of human natural killer cells.
23028591 Results suggest a protective role of KIR2DS5 in graft rejection and an association of KIR2DS4 with kidney rejection, particularly in recipients with glomerulonephritis.
22939905 in response to HCT therapy, the activating receptors are also enhanced by a process that increases the number of unmethylated sites present on KIR2DS2/4 promoters.
22128817 KIR1D/KIR1D might play a key role in Treponema pallidum infection in Chinese Han population that belongs to KIR gene haplotype A.
21596150 The CMV seropositivity of donors was not associated with activating KIR expression, and donor null expression in those with the KIR2DS2 or KIR2DS4 genotype was not predictive for CMV reactivation in the recipient.
21554925 Data indicate that the increased frequency of CD8(+) effector-memory T cells with activating NKR KIR2DS4, NKG2C and NKG2D, and cytotoxicity toward hematopoietic cell lines suggests involvement in bone marrow failure and clonal expansion in PNH.
21216870 KIR2DS4*001, the only allele of KIR2DS4 known to encode a functional activating receptor, was associated with relatively high viral load for HIV-1 and with accelerated transmission of HIV-1 to cohabiting seronegative partners.
20878400 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20371502 Observational study of gene-disease association. (HuGE Navigator)
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20207982 Observational study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20137308 Observational study of gene-disease association. (HuGE Navigator)
20082646 Observational study of genotype prevalence. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
20062104 significant association of full-length KIR2DS4 or KIR2DL1/3DL1 expression with the occurrence of acute graft vs host disease in hematopoietic stem cell transplantation
20034528 Observational study of gene-disease association. (HuGE Navigator)
19968064 Observational study of gene-disease association. (HuGE Navigator)
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19926642 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19897003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19875891 Observational study of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19859704 Data revealed that the trend of parasitic positive individuals to be KIR3DL1/KIR3DS1 heterozygous in pair with KIR2DS4 nondeleted variants in a set of KIR genes inheritable as the AB genotypes.
19859704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19858347 Determination of the crystallographic structure of KIR2DS4 shows two major differences from KIR2DL: displacement of contact loop L2 and altered bonding potential because of the substitutions at positions 71 and 72.
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19761533 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19664392 Observational study of gene-disease association. (HuGE Navigator)
19630074 Observational study of gene-disease association. (HuGE Navigator)
19589363 Observational study of genetic testing. (HuGE Navigator)
19552960 Findings in HCV-infected and non-infected IDUs suggest an important role for KIRs (KIR2DL2 and KIR2DL3) with group HLA-C1 molecules, in the presence of activating KIR2DS4, in protection from HCV infection.
19552960 Observational study of gene-disease association. (HuGE Navigator)
19527230 Observational study of gene-disease association. (HuGE Navigator)
19493232 Observational study of gene-disease association. (HuGE Navigator)
19489269 Observational study of gene-disease association. (HuGE Navigator)
19450876 Observational study of gene-disease association. (HuGE Navigator)
19421224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19410616 Observational study of gene-disease association. (HuGE Navigator)
19326408 Observational study of gene-disease association. (HuGE Navigator)
19309280 Observational study of gene-disease association. (HuGE Navigator)
19279038 Observational study of gene-disease association. (HuGE Navigator)
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
19046302 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19032228 Observational study of gene-disease association. (HuGE Navigator)
19000141 Observational study of genotype prevalence. (HuGE Navigator)
18945962 Observational study of gene-disease association. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18830515 Observational study of genotype prevalence. (HuGE Navigator)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18687225 Observational study of gene-disease association. (HuGE Navigator)
18681957 Observational study of gene-disease association. (HuGE Navigator)
18668235 Observational study of genotype prevalence. (HuGE Navigator)
18643961 Observational study of gene-disease association. (HuGE Navigator)
18632158 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18463675 The presence of KIR1D in the absence of KIR2DS4*001 was detected significantly more frequently in Chronic Myeloid Leukemia
18444913 Observational study of gene-disease association. (HuGE Navigator)
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18186800 Observational study of genotype prevalence. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17498266 Observational study of genotype prevalence. (HuGE Navigator)
17493145 Observational study of gene-disease association. (HuGE Navigator)
17490516 Observational study of gene-disease association. (HuGE Navigator)
17257315 Observational study of genotype prevalence. (HuGE Navigator)
17200871 Observational study of genotype prevalence. (HuGE Navigator)
17145370 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16641046 KIR 2DS4 may be a risk factor for susceptibility to RA in Taiwan.
16403292 Observational study of genotype prevalence. (HuGE Navigator)
15896204 Observational study of genotype prevalence. (HuGE Navigator)
15730517 Observational study of gene-disease association. (HuGE Navigator)
15265913 KIR2DS4 interacts with a non-class-I MHC protein on melanomas. This interaction is both specific & functional. Site-directed mutagenesis shows that the AAs involved in recognizing this novel ligand are different from those interacting with HLA-Cw4.

AA Sequence

MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTL      1 - 70
HLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQ     71 - 140
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQ    211 - 280
EPAGNRTVNSEDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (120)

PMID Year Title
26476204 2016 KIR2DS4 and Its Variant KIR1D Are Associated with Acute Graft-versus-Host Disease, Cytomegalovirus, and Overall Survival after Sibling-Related HLA-Matched Transplantation in Patients with Donors with KIR Gene Haplotype A.
26206121 2016 Genetic (KIR, HLA-C) and Some Clinical Parameters Influencing the Level of Liver Enzymes and Early Virologic Response in Patients with Chronic Hepatitis C.
26031759 2016 Killer immunoglobulin receptor genes and their HLA-C ligand are associated with Type 1 diabetes in an Eastern Indian population.
25961063 2015 Uptake of CCR7 by KIR2DS4? NK cells is induced upon recognition of certain HLA-C alleles.
25724317 2015 KIR2DS5 in the presence of HLA-C C2 protects against endometriosis.
25715101 2015 The HLA-C*04: 01/KIR2DS4 gene combination and human leukocyte antigen alleles with high population frequency drive rate of HIV disease progression.
25503311 2015 Novel insights in the genomic organization and hotspots of recombination in the human KIR locus through analysis of intergenic regions.
25069714 2014 Presence of the full-length KIR2DS4 gene reduces the chance of rheumatoid arthritis patients to respond to methotrexate treatment.
24239756 2013 KIR2DS4 allelic variants: Differential effects on in utero and intrapartum HIV-1 mother-to-child transmission.
24112428 2013 Natural killer cell activity and frequency of killer cell immunoglobulin-like receptors in children with different forms of juvenile idiopathic arthritis.
23354323 2013 Study of the KIR gene profiles and analysis of the phylogenetic relationships of Rajbanshi population of West Bengal, India.
23325834 2013 NK cell responses to cytomegalovirus infection lead to stable imprints in the human KIR repertoire and involve activating KIRs.
23028591 2012 Killer immunoglobulin-like receptor (KIR) and HLA genotypes affect the outcome of allogeneic kidney transplantation.
22939905 2012 KIR2DS2 and KIR2DS4 promoter hypomethylation patterns in patients undergoing hematopoietic cell transplantation (HCT).
22128817 2012 Association of KIR2DS4 and its variant KIR1D with syphilis in a Chinese Han population.
21596150 2011 Expression of activating KIR2DS2 and KIR2DS4 genes after hematopoietic cell transplantation: relevance to cytomegalovirus infection.
21554925 2011 T cells expressing the activating NK-cell receptors KIR2DS4, NKG2C and NKG2D are elevated in paroxysmal nocturnal hemoglobinuria and cytotoxic toward hematopoietic progenitor cell lines.
21216870 2011 Impact of a functional KIR2DS4 allele on heterosexual HIV-1 transmission among discordant Zambian couples.
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20371502 2010 Association of killer cell immunoglobulin-like receptor 2DL5 with systemic lupus erythematosus and accompanying infections.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20207982 2010 Natural killer-cell receptor polymorphisms and posttransplantation non-Hodgkin lymphoma.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20137308 2009 [Relationship between CMV reactivation and KIR haplotype/HLA-Cw genotype in patients after unrelated-donor hematopoietic stem cell transplantation.].
20082646 2010 Killer cell immunoglobulin-like receptor gene diversity in a Caucasian population of southern Brazil.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
20062104 2010 The impact of KIR2DS4 alleles and the expression of KIR in the development of acute GVHD after unrelated allogeneic hematopoietic SCT.
20034528 2010 Distribution of killer cell immunoglobulin-like receptor genes and 2DS4 alleles in the Chinese Han population.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19926642 2010 Disparate distribution of activating and inhibitory killer cell immunoglobulin-like receptor genes in patients with systemic lupus erythematosus.
19897003 2010 Killer cell immunoglobulin-like receptor gene-cluster 3DS1-2DL5-2DS1-2DS5 predisposes susceptibility to Vogt-Koyanagi-Harada syndrome in Japanese individuals.
19875891 2009 Frequencies of killer immunoglobulin-like receptor genotypes influence susceptibility to spontaneous abortion.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19859704 2009 KIR3DL1/S1 genotypes and KIR2DS4 allelic variants in the AB KIR genotypes are associated with Plasmodium-positive individuals in malaria infection.
19858347 2009 KIR2DS4 is a product of gene conversion with KIR3DL2 that introduced specificity for HLA-A*11 while diminishing avidity for HLA-C.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19664392 2009 [Genotype analysis of killer cell immunoglobulin-like receptors in Graves' disease patients].
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19589363 2009 Killer cell immunoglobulin-like receptor allele discrimination by high-resolution melting.
19552960 2009 Protective KIR-HLA interactions for HCV infection in intravenous drug users.
19527230 2009 Activating killer cell immunoglobulin-like receptor genes' association with recurrent miscarriage.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19489269 2009 [Genotype and haplotype analysis of killer cell immunoglobulin-like receptors in ankylosing spondylitis].
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19421224 2009 Multiple sclerosis associates with LILRA3 deletion in Spanish patients.
19410616 2009 In contrast to other stimulatory natural killer cell immunoglobulin-like receptor loci, several KIR2DS5 alleles predominate in African Americans.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19309280 2009 Distribution of killer cell immunoglobulin-like receptor (KIR) genotypes in patients with familial Mediterranean fever.
19279038 2009 Influence of activating and inhibitory killer immunoglobulin-like receptors on predisposition to recurrent miscarriages.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
19000141 2009 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Java, Kalimantan, Timor and Irian Jaya.
18945962 2009 Donors with group B KIR haplotypes improve relapse-free survival after unrelated hematopoietic cell transplantation for acute myelogenous leukemia.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of ParanĂ¡.
18830515 2008 Natural killer cells and immune surveillance.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18687225 2008 [Study on the polymorphism of killer cell immunoglobulin like receptor (KIR) gene with systemic lupus erythematosus of North population in China].
18681957 2008 NullHap--a versatile application to estimate haplotype frequencies from unphased genotypes in the presence of null alleles.
18668235 2008 Asian population frequencies and haplotype distribution of killer cell immunoglobulin-like receptor (KIR) genes among Chinese, Malay, and Indian in Singapore.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18632158 2008 Genetic interactions of KIR and G1M immunoglobulin allotypes differ in obese from non-obese individuals with type 2 diabetes.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18463675 2008 Association of KIR2DS4 and its variant KIR1D with leukemia.
18444913 2008 The number of activating KIR genes inversely correlates with the rate of CMV infection/reactivation in kidney transplant recipients.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18186800 2008 Distribution of KIR genes in the Czech population.
17868255 2007 No association of KIR genes with Behcet's disease.
17498266 2007 KIR genes polymorphism in Argentinean Caucasoid and Amerindian populations.
17493145 2007 Analysis of KIR gene frequencies in HLA class I characterised bladder, colorectal and laryngeal tumours.
17490516 2007 [Polymorphism of killer cell immunoglobulin-like receptor gene and its correlation with leukemia].
17321903 2007 Studies on the expression of the deleted KIR2DS4*003 gene product and distribution of KIR2DS4 deleted and nondeleted versions in different populations.
17257315 2007 Diversity of the killer cell immunoglobulin-like receptor gene KIR2DS4 in the Chinese population.
17200871 2007 KIR haplotype content at the allele level in 77 Northern Irish families.
17145370 2006 Interaction of KIR genes and G1M immunoglobulin allotypes confer susceptibility to type 2 diabetes in Puerto Rican Americans.
16641046 Killer cell immunoglobulin-like receptor gene's repertoire in rheumatoid arthritis.
16403292 2005 [Polymorphism of killer cell immunoglobulin-like receptors gene family in Zhejiang Han population].
15896204 2005 Distribution of killer cell immunoglobulin-like receptor genes in the Chinese Han population.
15730517 2005 A population-based cohort study of KIR genes and genotypes in relation to cervical intraepithelial neoplasia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15265913 2004 MHC class I-independent recognition of NK-activating receptor KIR2DS4.
15219381 2004 Investigation of killer cell immunoglobulin-like receptor gene diversity: II. KIR2DS4.
14607943 2003 Activation of a subset of human NK cells upon contact with Plasmodium falciparum-infected erythrocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445308 2002 A common KIR2DS4 deletion variant in the human that predicts a soluble KIR molecule analogous to the KIR1D molecule observed in the rhesus monkey.
12391228 2002 Killer Ig-like receptor haplotype analysis by gene content: evidence for genomic diversity with a minimum of six basic framework haplotypes, each with multiple subsets.
11390475 2001 Recognition of HLA-Cw4 but not HLA-Cw6 by the NK cell receptor killer cell Ig-like receptor two-domain short tail number 4.
11169255 2001 Identification of seventeen novel KIR variants: fourteen of them from two non-Caucasian donors.
10816589 2000 Cobalt-mediated dimerization of the human natural killer cell inhibitory receptor.
10424431 1999 Diversity of the repertoire of p58 killer cell inhibitory receptors in a single individual.
9521070 1998 Signaling through human killer cell activating receptors triggers tyrosine phosphorylation of an associated protein complex.
9378975 1997 Molecular basis of HLA-C recognition by p58 natural killer cell inhibitory receptors.
8765026 1996 A novel surface molecule homologous to the p58/p50 family of receptors is selectively expressed on a subset of human natural killer cells and induces both triggering of cell functions and proliferation.
8662091 1996 Alternatively spliced forms of human killer inhibitory receptors.
7749980 1995 Molecular clones of the p58 NK cell receptor reveal immunoglobulin-related molecules with diversity in both the extra- and intracellular domains.