Property Summary

NCBI Gene PubMed Count 93
PubMed Score 0.00
PubTator Score 7.65

Knowledge Summary

Patent

No data available

Gene RIF (85)

PMID Text
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
24929143 The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases.
23826153 the presence of host genetic risk factors, IL28B-T and KIR2DS3 alleles, resulted in increased odds of treatment failure in these rapid virological response negative patients.
22653583 Data found that the frequencies of KIR2DS1, 2DS3 and 3DS1 were significantly higher in pulmonary tuberculosis patients than in the control group.
22219647 KIR2DS3 and HLA-class I alleles (-Cw*14 and -Cw*17) may play a role in the pathogenesis of the Vogt-Koyanagi-Harada disease.
21402922 The Natural Killer cell gene KIR2DS3 was significantly increased in patients with chronic hepatitis C virus infection.
20878400 Study showed that the activating KIR2DS1 and KIR2DS3 genes associate with fatal outcome in Ebola virus infection.
20878400 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20528243 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20371915 KIR2DS3 is associated with protection against acute myeloid leukemia.
20371502 Observational study of gene-disease association. (HuGE Navigator)
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20207982 Observational study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20137308 Observational study of gene-disease association. (HuGE Navigator)
20082646 Observational study of genotype prevalence. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
19968064 Observational study of gene-disease association. (HuGE Navigator)
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19926642 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19897003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19875891 Observational study of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19761533 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19664392 Observational study of gene-disease association. (HuGE Navigator)
19630074 Observational study of gene-disease association. (HuGE Navigator)
19527230 Observational study of gene-disease association. (HuGE Navigator)
19500138 KIR2DS3 incompatibilities increased risk of chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation
19493232 Observational study of gene-disease association. (HuGE Navigator)
19489269 Observational study of gene-disease association. (HuGE Navigator)
19450876 Observational study of gene-disease association. (HuGE Navigator)
19421224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19410616 Observational study of gene-disease association. (HuGE Navigator)
19326408 Observational study of gene-disease association. (HuGE Navigator)
19309280 Observational study of gene-disease association. (HuGE Navigator)
19279038 Observational study of gene-disease association. (HuGE Navigator)
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
19046302 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19032228 Observational study of gene-disease association. (HuGE Navigator)
19005473 Dramatically reduced surface expression of NK cell receptor KIR2DS3 is attributed to multiple residues throughout the molecule.
19000141 Observational study of genotype prevalence. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18830515 Observational study of genotype prevalence. (HuGE Navigator)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18764809 Genomic and mRNA sequences support the KIR2DS3*002 gene being a hybrid of KIR2DS3*00103 and KIR2DS5.
18687225 Observational study of gene-disease association. (HuGE Navigator)
18681957 Observational study of gene-disease association. (HuGE Navigator)
18668235 Observational study of genotype prevalence. (HuGE Navigator)
18643961 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18480828 This focuses on the inheritance of KIR2DS3*001 and *002 to clarify their genetic relationship, and will investigate the diversity of haplotypes containing a KIR2DS3 gene.
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18074414 Observational study of gene-disease association. (HuGE Navigator)
17882223 Observational study of gene-disease association. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17498266 Observational study of genotype prevalence. (HuGE Navigator)
17462498 KIR2DS3 is a protective factor for chronic graft-versus-host disease.
16829306 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16508981 Observational study of gene-disease association. (HuGE Navigator)
16403292 Observational study of genotype prevalence. (HuGE Navigator)
15896204 Observational study of genotype prevalence. (HuGE Navigator)
12559621 Positive linkage disequilibrium was seen between KRI2DS2 and KIR2DS3. Positive linkage disequilibrium was seen between KIR3DS1 and KIR2DS3.

AA Sequence

MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTL      1 - 70
RLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWS    141 - 210
KSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQ    211 - 280
GPAGNRTVNREDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (93)

PMID Year Title
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
24929143 2014 Killer-cell immunoglobulin-like receptors and falciparum malaria in southwest Nigeria.
23826153 2013 Variation in both IL28B and KIR2DS3 genes influence pegylated interferon and ribavirin hepatitis C treatment outcome in HIV-1 co-infection.
23394822 2013 Recombinant structures expand and contract inter and intragenic diversification at the KIR locus.
22653583 2012 Association of killer cell immunoglobulin-like receptors with pulmonary tuberculosis in Chinese Han.
22219647 2011 A study of KIR genes and HLA-C in Vogt-Koyanagi-Harada disease in Saudi Arabia.
21402922 2011 Innate immune genes synergize to predict increased risk of chronic disease in hepatitis C virus infection.
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20528243 2010 Killer cell immunoglobulin-like receptor gene polymorphism in lymphoproliferative diseases of granular lymphocytes in a Japanese population.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20371915 2010 KIR2DS3 is associated with protection against acute myeloid leukemia.
20371502 2010 Association of killer cell immunoglobulin-like receptor 2DL5 with systemic lupus erythematosus and accompanying infections.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20207982 2010 Natural killer-cell receptor polymorphisms and posttransplantation non-Hodgkin lymphoma.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20137308 2009 [Relationship between CMV reactivation and KIR haplotype/HLA-Cw genotype in patients after unrelated-donor hematopoietic stem cell transplantation.].
20082646 2010 Killer cell immunoglobulin-like receptor gene diversity in a Caucasian population of southern Brazil.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19926642 2010 Disparate distribution of activating and inhibitory killer cell immunoglobulin-like receptor genes in patients with systemic lupus erythematosus.
19897003 2010 Killer cell immunoglobulin-like receptor gene-cluster 3DS1-2DL5-2DS1-2DS5 predisposes susceptibility to Vogt-Koyanagi-Harada syndrome in Japanese individuals.
19875891 2009 Frequencies of killer immunoglobulin-like receptor genotypes influence susceptibility to spontaneous abortion.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19664392 2009 [Genotype analysis of killer cell immunoglobulin-like receptors in Graves' disease patients].
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19527230 2009 Activating killer cell immunoglobulin-like receptor genes' association with recurrent miscarriage.
19500138 2009 Activating killer immunoglobulin-like receptor incompatibilities enhance graft-versus-host disease and affect survival after allogeneic hematopoietic stem cell transplantation.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19489269 2009 [Genotype and haplotype analysis of killer cell immunoglobulin-like receptors in ankylosing spondylitis].
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19421224 2009 Multiple sclerosis associates with LILRA3 deletion in Spanish patients.
19410616 2009 In contrast to other stimulatory natural killer cell immunoglobulin-like receptor loci, several KIR2DS5 alleles predominate in African Americans.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19309280 2009 Distribution of killer cell immunoglobulin-like receptor (KIR) genotypes in patients with familial Mediterranean fever.
19279038 2009 Influence of activating and inhibitory killer immunoglobulin-like receptors on predisposition to recurrent miscarriages.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
19005473 2009 Dramatically reduced surface expression of NK cell receptor KIR2DS3 is attributed to multiple residues throughout the molecule.
19000141 2009 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Java, Kalimantan, Timor and Irian Jaya.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of ParanĂ¡.
18830515 2008 Natural killer cells and immune surveillance.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18764809 2008 The 5' intergenic, promoter, pseudoexon 3 and complete coding sequences of the hybrid gene KIR2DS3*002.
18687225 2008 [Study on the polymorphism of killer cell immunoglobulin like receptor (KIR) gene with systemic lupus erythematosus of North population in China].
18681957 2008 NullHap--a versatile application to estimate haplotype frequencies from unphased genotypes in the presence of null alleles.
18668235 2008 Asian population frequencies and haplotype distribution of killer cell immunoglobulin-like receptor (KIR) genes among Chinese, Malay, and Indian in Singapore.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18480828 2008 Duplication, mutation and recombination of the human orphan gene KIR2DS3 contribute to the diversity of KIR haplotypes.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18074414 2007 Polymorphisms of killer cell immunoglobulin-like receptor gene: possible association with susceptibility to or clearance of hepatitis B virus infection in Chinese Han population.
17882223 2007 Associations of killer cell immunoglobulin-like receptor genes with complications of rheumatoid arthritis.
17868255 2007 No association of KIR genes with Behcet's disease.
17498266 2007 KIR genes polymorphism in Argentinean Caucasoid and Amerindian populations.
17462498 2007 Donor-recipient combinations of group A and B KIR haplotypes and HLA class I ligand affect the outcome of HLA-matched, sibling donor hematopoietic cell transplantation.
16829306 2006 A role for KIR gene variants other than KIR2DS1 in conferring susceptibility to psoriasis.
16508981 2006 Association of killer cell immunoglobulin-like receptor genotypes with microscopic polyangiitis.
16403292 2005 [Polymorphism of killer cell immunoglobulin-like receptors gene family in Zhejiang Han population].
15896204 2005 Distribution of killer cell immunoglobulin-like receptor genes in the Chinese Han population.
15496913 2004 Finishing the euchromatic sequence of the human genome.
12559621 2003 Assessment of killer cell immunoglobulinlike receptor expression and corresponding HLA class I phenotypes demonstrates heterogenous KIR expression independent of anticipated HLA class I ligands.
11237011 2001 Initial sequencing and analysis of the human genome.
9430221 1997 Human diversity in killer cell inhibitory receptor genes.
9430220 1997 Functionally and structurally distinct NK cell receptor repertoires in the peripheral blood of two human donors.
8765026 1996 A novel surface molecule homologous to the p58/p50 family of receptors is selectively expressed on a subset of human natural killer cells and induces both triggering of cell functions and proliferation.
8662091 1996 Alternatively spliced forms of human killer inhibitory receptors.
7749980 1995 Molecular clones of the p58 NK cell receptor reveal immunoglobulin-related molecules with diversity in both the extra- and intracellular domains.