Property Summary

NCBI Gene PubMed Count 146
PubMed Score 0.00
PubTator Score 78.69

Knowledge Summary

Patent

No data available

Gene RIF (127)

PMID Text
26574972 this study was to look for immunogenetic determinants in the pathogenesis of FMF and find out if KIR are related to susceptibility. An activator KIR gene, KIR2DS2, was significantly more frequent in FMF patients (p=0.036).
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26430804 Single Nucleotide Polymorphism in KIR2DS2 gene is associated with Asthma and Atopic Dermatitis.
26202659 a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found.
25636579 genetic polymorphism is associated with chronic hepatitis C and levels of viremia in Poland
25575065 KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population.
25484131 CD4(+) CD28(-) cells exhibited increased KIR2DS2, reduced KIR2DL3 and increased DAP12 expression in HD-ESRD compared with NDD-CKD patients.
25381437 NK cells with KIR2DS2 immunogenotype have a functional activation advantage to efficiently kill glioblastoma and prolong animal survival.
24550293 Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.
24185760 There is an association of the KIR2DS gene, especially KIR2DS2, with psoriatic arthritis.
24122895 Authors showed a significant increased correlation between KIR2DL2/DS2, type 2 diabetes and HLA-C1C1 genotype in the type 2 diabetes patients infected with human herpesvirus 8.
23974321 Analysis of this large cohort from Uganda in the context of other African populations reveals variations in KIR and HLA-C1 and C2 that are consistent with migrations within Africa and potential selection pressures on these genes.
23380384 Data indicate that increased frequency of the activating receptor KIR2DS1 and a reduced frequency of the KIR-ligand combination KIR2DS2/2DL2 absent/C1 present were significantly associated with chronic myeloid leukemia (CML).
23325834 Our data revealed a unique contribution of activating KIRs (KIR2DS4, KIR2DS2, or KIR3DS1), in addition to NKG2C, in the expansion of human natural killer cells.
22960345 presence of KIR2DS2 is associated with rheumatoid arthritis.
22939905 in response to HCT therapy, the activating receptors are also enhanced by a process that increases the number of unmethylated sites present on KIR2DS2/4 promoters.
22836042 individuals possessing KIR2DL2 and/or KIR2DS2 (and, in most cases, also KIR2DL1) gene but no HLA-C C2 ligand may respond better to treatment and survive longer than people bearing other genotypes.
22509813 The frequency of the combination of HLA-C1 allele group with KIR2DS2 was significantly higher in severe dry eye disease patients.
22065905 This study showed a significantly lower frequency of KIR2DS2 among chronic HCV carriers compared with controls in a Korean population
22024796 In a comparison of healthy controls and a tightly defined cohort of adult ITP patients, the KIR2DS2/KIR2DL2 genotype was found to be associated with ITP independently of FCGR3a-158 polymorphisms.
21596150 The CMV seropositivity of donors was not associated with activating KIR expression, and donor null expression in those with the KIR2DS2 or KIR2DS4 genotype was not predictive for CMV reactivation in the recipient.
21593779 KIR2DS2*005 encodes a molecule expressed on the surface of natural killer- and T-lymphocytes.
21373785 KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy.
21233146 predisposition to systemic lupus erythematosus was associated with GTGT deletion at the SLC11A1 3'UTR, presence of KIR2DS2 +/KIR2DS5 +/KIR3DS1 + profile, increased number of stimulatory KIR genes and European and Amerindian ancestries
21165439 indicated nonspecific stimulation of natural killers, probably mediated by an increase in serum concentration of heat shock protein with a molecular weight of 70 kDa
20878400 Observational study of gene-disease association. (HuGE Navigator)
20802150 an evolutionary trend toward reducing the avidity of the activating C1- and C2-specific receptors is exempllified by KIR2DS2, an activating C1-specific receptor that has lost all detectable avidity for HLA class I.
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20528243 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20371502 Observational study of gene-disease association. (HuGE Navigator)
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20207982 Single nucleotide polymorphism in KIR2DS2 gene is associated with posttransplantation non-Hodgkin lymphoma.
20207982 Observational study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20137308 Observational study of gene-disease association. (HuGE Navigator)
20082646 Observational study of genotype prevalence. (HuGE Navigator)
20082621 Observational study of gene-disease association. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
19968064 Observational study of gene-disease association. (HuGE Navigator)
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19926642 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19897003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19877200 Absence of KIR2DS2 and/or KIR2DL2 is associated with failure of antiviral therapy in patients with recurrent hepatitis C after liver transplantation
19875891 Observational study of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19830740 Data show that sHLA-Cw4 or sHLA-Cw3 alleles induced secretion of TGF-beta1 by ligation of stimulatory KIR2DS1 or KIR2DS2 isoforms.
19761533 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19664392 Observational study of gene-disease association. (HuGE Navigator)
19630074 Observational study of gene-disease association. (HuGE Navigator)
19527230 Observational study of gene-disease association. (HuGE Navigator)
19493232 a model in chronic myeloid leukemia of protection via KIR2DL2 and/or KIR2DS2 with the presence of the ligand HLA-C1 group and susceptibility via HLA-Bw4 homozygosity (i.e. absence of HLA-Bw6) was proposed.
19493232 Observational study of gene-disease association. (HuGE Navigator)
19489269 Observational study of gene-disease association. (HuGE Navigator)
19450876 Observational study of gene-disease association. (HuGE Navigator)
19421224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19410616 reduced allele frequency in African Americans
19410616 Observational study of gene-disease association. (HuGE Navigator)
19326408 Observational study of gene-disease association. (HuGE Navigator)
19309280 Observational study of gene-disease association. (HuGE Navigator)
19279038 Observational study of gene-disease association. (HuGE Navigator)
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
19046302 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19000141 Observational study of genotype prevalence. (HuGE Navigator)
18976447 KIR gene frequencies in Poles are close to these in other Caucasoids but different from those in Asian and African populations, and particularly distant from those in Australian Aborigines
18945962 Observational study of gene-disease association. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18830515 Observational study of genotype prevalence. (HuGE Navigator)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18755860 Observational study of gene-disease association. (HuGE Navigator)
18687225 Observational study of gene-disease association. (HuGE Navigator)
18681957 Observational study of gene-disease association. (HuGE Navigator)
18668235 Observational study of genotype prevalence. (HuGE Navigator)
18643961 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18340360 A profound effect of KIR2DS2/S3/S4 in the absence of strong inhibition may enhance the activation of natural killer cells and T-cell subsets against intraocular self-antigens, thereby contributing to pathogenesis of birdshot chorioretinopathy.
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18292496 In contrast to natural killer (NK) cells, the functions of killer inhibitory receptors in CD4+ T lymphocytes might derive from a selective expression of their activating (CD158j) or inhibiting forms.
18158964 Observational study of gene-disease association. (HuGE Navigator)
18091530 Observational study of gene-disease association. (HuGE Navigator)
18074414 Observational study of gene-disease association. (HuGE Navigator)
17882223 Observational study of gene-disease association. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17498266 Observational study of genotype prevalence. (HuGE Navigator)
17497034 Data show that there was no correlation between CD158b expression and disease activity in rheumatoid arthritis.
17490516 Observational study of gene-disease association. (HuGE Navigator)
17445184 Observational study of gene-disease association. (HuGE Navigator)
17445184 Lack of KIR2DS2 is associated with poor graft function
17445179 Observational study of gene-disease association. (HuGE Navigator)
17445179 Significantly increased KIR2DS2 is associated with systemic lupus erythematosus and scleroderma
17200871 Observational study of genotype prevalence. (HuGE Navigator)
16929347 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16623599 A study evaluating how transmembrane sequences flanking the polar interaction site contribute to assembly for three receptors that associate with different signaling modules is presented.
16504727 The presence of KIR2DS2 gene in the donor is associated with a high risk of mortality following unrelated donor-hematopoietic cell transplantation.
16403292 Observational study of genotype prevalence. (HuGE Navigator)
16112031 Observational study of gene-disease association. (HuGE Navigator)
15896204 Observational study of genotype prevalence. (HuGE Navigator)
15699512 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15699512 KIR2DS2 is positively associated with diabetes mellitus, type 1.
15356118 KIR2DS2 associates with alternative adapter molecules (e.g., KARAP/DAP12), leading to differential signaling mechanisms and cellular activation.
15146426 The genetic combination of KIR2DS2+ and KIR2DL2- is associated with scleroderma.
14514651 An increase in activating KIR2DS2-HLA ligand pairs combined with a lack of inhibitory KIR-HLA ligand pairs is associated with an additional risk to develop type 1 diabetes in individuals with diabetes high-risk HLA alleles.
12668644 Crystal structure of the human natural killer cell activating receptor KIR2DS2 (CD158j).
12591902 CD158j in T cells functions as a costimulatory molecule through the JNK pathway independent of KARAP/DAP12 and DAP10.
12559621 Positive linkage disequilibrium was seen between KRI2DS2 and KIR2DS3.
11369787 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQ    211 - 280
EPAGNRTVNSEDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (146)

PMID Year Title
26574972 2015 Killer Cell Immunoglobulin-Like Receptor (KIR) Genotype Distribution in Familial Mediterranean Fever (FMF) Patients.
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26430804 2015 Imputation of KIR Types from SNP Variation Data.
26202659 2015 Increased frequencies of the killer immunoglobulin-like receptor genes KIR2DL2 and KIR2DS2 are associated with neuroblastoma.
25636579 2015 Contribution of genes for killer cell immunoglobulin-like receptors (KIR) to the susceptibility to chronic hepatitis C virus infection and to viremia.
25575065 2015 [Correlation analysis between killer cell immunoglobulin-like receptor gene polymorphism and primary biliary cirrhosis].
25484131 2015 Killer cell immunoglobulin receptor profile on CD4(+)  CD28(-) T cells and their pathogenic role in non-dialysis-dependent and dialysis-dependent chronic kidney disease patients.
25381437 2014 NK cells with KIR2DS2 immunogenotype have a functional activation advantage to efficiently kill glioblastoma and prolong animal survival.
24571473 2014 The presence of KIR2DS5 confers protection against adult immune thrombocytopenia.
24550293 2014 Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.
24369024 2014 KIR and HLA interactions are associated with control of primary CMV infection in solid organ transplant recipients.
24349500 2013 KIR, HLA, and IL28B variant predict response to antiviral therapy in genotype 1 chronic hepatitis C patients in Japan.
24312130 2013 Combination of human leukocyte antigen and killer cell immunoglobulin-like receptor genetic background influences the onset age of hepatocellular carcinoma in male patients with hepatitis B virus infection.
24185760 2014 Killer-cell immunoglobulin-like receptor gene polymorphisms and susceptibility to psoriatic arthritis.
24122895 2014 High prevalence of HHV8 infection and specific killer cell immunoglobulin-like receptors allotypes in Sardinian patients with type 2 diabetes mellitus.
24112428 2013 Natural killer cell activity and frequency of killer cell immunoglobulin-like receptors in children with different forms of juvenile idiopathic arthritis.
24078689 2013 Large spectrum of HLA-C recognition by killer Ig-like receptor (KIR)2DL2 and KIR2DL3 and restricted C1 SPECIFICITY of KIR2DS2: dominant impact of KIR2DL2/KIR2DS2 on KIR2D NK cell repertoire formation.
24011088 2013 Human papillomavirus, high-grade intraepithelial neoplasia and killer immunoglogulin-like receptors: a Western Australian cohort study.
23974321 2013 Killer cell immunoglobulin-like receptor (KIR) genes and their HLA-C ligands in a Ugandan population.
23380384 2013 Homozygosity for killer immunoglobin-like receptor haplotype A predicts complete molecular response to treatment with tyrosine kinase inhibitors in chronic myeloid leukemia patients.
23325834 2013 NK cell responses to cytomegalovirus infection lead to stable imprints in the human KIR repertoire and involve activating KIRs.
22960345 2012 Associations of killer cell immunoglobulin- like receptor genes with rheumatoid arthritis.
22939905 2012 KIR2DS2 and KIR2DS4 promoter hypomethylation patterns in patients undergoing hematopoietic cell transplantation (HCT).
22836042 2012 KIR2DL2/S2 and HLA-C C1C1 genotype is associated with better response to treatment and prolonged survival of patients with non-small cell lung cancer in a Polish Caucasian population.
22509813 2012 Association of killer cell immunoglobulin-like receptor and human leukocyte antigen-C genotype with dry eye disease in a Chinese Han population.
22065905 2011 Frequency of killer cell immunoglobulin-like receptors (KIRs) in Korean patients with chronic HCV infection.
22024796 2012 The KIR2DS2/DL2 genotype is associated with adult persistent/chronic and relapsed immune thrombocytopenia independently of FCGR3a-158 polymorphisms.
21596150 2011 Expression of activating KIR2DS2 and KIR2DS4 genes after hematopoietic cell transplantation: relevance to cytomegalovirus infection.
21593779 2011 Molecular characterisation of KIR2DS2*005, a fusion gene associated with a shortened KIR haplotype.
21373785 2012 Killer immunoglobulin-like receptor and human leukocyte antigen-C genotypes in rheumatoid arthritis primary responders and non-responders to anti-TNF-? therapy.
21233146 2011 Systemic lupus erythematosus: association with KIR and SLC11A1 polymorphisms, ethnic predisposition and influence in clinical manifestations at onset revealed by ancestry genetic markers in an urban Brazilian population.
21165439 2010 Expression of KIR2DL3 and KIR2DS2 natural killer receptors in exercise.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20802150 2010 Humans differ from other hominids in lacking an activating NK cell receptor that recognizes the C1 epitope of MHC class I.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20528243 2010 Killer cell immunoglobulin-like receptor gene polymorphism in lymphoproliferative diseases of granular lymphocytes in a Japanese population.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20371502 2010 Association of killer cell immunoglobulin-like receptor 2DL5 with systemic lupus erythematosus and accompanying infections.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20207982 2010 Natural killer-cell receptor polymorphisms and posttransplantation non-Hodgkin lymphoma.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20137308 2009 [Relationship between CMV reactivation and KIR haplotype/HLA-Cw genotype in patients after unrelated-donor hematopoietic stem cell transplantation.].
20082646 2010 Killer cell immunoglobulin-like receptor gene diversity in a Caucasian population of southern Brazil.
20082621 2010 Killer cell immunoglobulin-like receptor (KIR) genes in systemic sclerosis.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19926642 2010 Disparate distribution of activating and inhibitory killer cell immunoglobulin-like receptor genes in patients with systemic lupus erythematosus.
19897003 2010 Killer cell immunoglobulin-like receptor gene-cluster 3DS1-2DL5-2DS1-2DS5 predisposes susceptibility to Vogt-Koyanagi-Harada syndrome in Japanese individuals.
19877200 2009 Lack of killer immunoglobulin-like receptor 2DS2 (KIR2DS2) and KIR2DL2 is associated with poor responses to therapy of recurrent hepatitis C virus in liver transplant recipients.
19875891 2009 Frequencies of killer immunoglobulin-like receptor genotypes influence susceptibility to spontaneous abortion.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19830740 2009 Soluble HLA-I-mediated secretion of TGF-beta1 by human NK cells and consequent down-regulation of anti-tumor cytolytic activity.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19664392 2009 [Genotype analysis of killer cell immunoglobulin-like receptors in Graves' disease patients].
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19527230 2009 Activating killer cell immunoglobulin-like receptor genes' association with recurrent miscarriage.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19489269 2009 [Genotype and haplotype analysis of killer cell immunoglobulin-like receptors in ankylosing spondylitis].
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19421224 2009 Multiple sclerosis associates with LILRA3 deletion in Spanish patients.
19410616 2009 In contrast to other stimulatory natural killer cell immunoglobulin-like receptor loci, several KIR2DS5 alleles predominate in African Americans.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19309280 2009 Distribution of killer cell immunoglobulin-like receptor (KIR) genotypes in patients with familial Mediterranean fever.
19279038 2009 Influence of activating and inhibitory killer immunoglobulin-like receptors on predisposition to recurrent miscarriages.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19000141 2009 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Java, Kalimantan, Timor and Irian Jaya.
18976447 2008 Distribution of killer cell immunoglobulin-like receptor genes in Poles.
18945962 2009 Donors with group B KIR haplotypes improve relapse-free survival after unrelated hematopoietic cell transplantation for acute myelogenous leukemia.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of Paraná.
18830515 2008 Natural killer cells and immune surveillance.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18755860 2008 Association of killer cell immunoglobulin-like receptor genotypes with vascular arterial events and anticardiolipin antibodies in patients with lupus.
18687225 2008 [Study on the polymorphism of killer cell immunoglobulin like receptor (KIR) gene with systemic lupus erythematosus of North population in China].
18681957 2008 NullHap--a versatile application to estimate haplotype frequencies from unphased genotypes in the presence of null alleles.
18668235 2008 Asian population frequencies and haplotype distribution of killer cell immunoglobulin-like receptor (KIR) genes among Chinese, Malay, and Indian in Singapore.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18292496 2008 Cutting edge: selective expression of inhibitory or activating killer cell Ig-like receptors in circulating CD4+ T lymphocytes.
18158964 2008 Donor killer immunoglobulin-like receptor (KIR) genotype-patient cognate KIR ligand combination and antithymocyte globulin preadministration are critical factors in outcome of HLA-C-KIR ligand-mismatched T cell-replete unrelated bone marrow transplantation.
18091530 2007 KIR/HLA ligand incompatibility in kidney transplantation.
18074414 2007 Polymorphisms of killer cell immunoglobulin-like receptor gene: possible association with susceptibility to or clearance of hepatitis B virus infection in Chinese Han population.
17882223 2007 Associations of killer cell immunoglobulin-like receptor genes with complications of rheumatoid arthritis.
17868255 2007 No association of KIR genes with Behcet's disease.
17767567 2007 An apparent KIR2DS2-negative KIR2DL2-positive genotype discloses the novel allele KIR2DS2*00104.
17498266 2007 KIR genes polymorphism in Argentinean Caucasoid and Amerindian populations.
17497034 2007 No correlation exists between disease activity and the expression of killer-cell immunoglobulin-like receptors in patients with rheumatoid arthritis.
17490516 2007 [Polymorphism of killer cell immunoglobulin-like receptor gene and its correlation with leukemia].
17445184 2007 Killer cell immunoglobulin-like receptor polymorphisms in HLA-identical kidney transplant recipients: lack of 2DL2 and 2DS2 may be associated with poor graft function.
17445179 2007 KIRs and autoimmune disease: studies in systemic lupus erythematosus and scleroderma.
17200871 2007 KIR haplotype content at the allele level in 77 Northern Irish families.
16929347 2006 Killer Ig-like receptor (KIR) genotype and HLA ligand combinations in ulcerative colitis susceptibility.
16824023 2006 The killer immunoglobulin-like receptor gene cluster: tuning the genome for defense.
16623599 2006 The assembly of diverse immune receptors is focused on a polar membrane-embedded interaction site.
16504727 Impact of activating killer immunoglobulin-like receptor genotype on outcome of unrelated donor-hematopoietic cell transplantation.
16403292 2005 [Polymorphism of killer cell immunoglobulin-like receptors gene family in Zhejiang Han population].
16112031 2005 Activating killer cell immunoglobulin-like receptor gene KIR2DS1 is associated with psoriatic arthritis.
15896204 2005 Distribution of killer cell immunoglobulin-like receptor genes in the Chinese Han population.
15699512 2004 Killer cell immunoglobulin-like receptor genes in Latvian patients with type 1 diabetes mellitus and healthy controls.
15580655 2005 The KIR gene family: life in the fast lane of evolution.
15356118 2004 Stimulatory killer Ig-like receptors modulate T cell activation through DAP12-dependent and DAP12-independent mechanisms.
15194195 2004 Comparative genomic analysis, diversity and evolution of two KIR haplotypes A and B.
15146426 2004 Association of killer cell immunoglobulin-like receptors with scleroderma.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14607943 2003 Activation of a subset of human NK cells upon contact with Plasmodium falciparum-infected erythrocytes.
14514651 2003 KIR in type 1 diabetes: disparate distribution of activating and inhibitory natural killer cell receptors in patients versus HLA-matched control subjects.
12668644 2003 Crystal structure of the human natural killer cell activating receptor KIR2DS2 (CD158j).
12591902 2003 Selective activation of the c-Jun NH2-terminal protein kinase signaling pathway by stimulatory KIR in the absence of KARAP/DAP12 in CD4+ T cells.
12559621 2003 Assessment of killer cell immunoglobulinlike receptor expression and corresponding HLA class I phenotypes demonstrates heterogenous KIR expression independent of anticipated HLA class I ligands.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470774 2001 Biphasic response of NK cells expressing both activating and inhibitory killer Ig-like receptors.
11369787 2001 Major histocompatibility complex class I-recognizing receptors are disease risk genes in rheumatoid arthritis.
11172020 2001 The role of zinc in the binding of killer cell Ig-like receptors to class I MHC proteins.
11169398 2000 Identification and molecular characterization of a natural mutant of the p50.2/KIR2DS2 activating NK receptor that fails to mediate NK cell triggering.
11169255 2001 Identification of seventeen novel KIR variants: fourteen of them from two non-Caucasian donors.
10658980 2000 HLA-class I-specific inhibitory receptors in HIV-1 infection.
10424431 1999 Diversity of the repertoire of p58 killer cell inhibitory receptors in a single individual.
9497500 1997 The repertoire of HLA-Cw-specific NK cell receptors CD158 a/b (EB6 and GL183) in individuals with different HLA phenotypes.
9490415 1998 Immunoreceptor DAP12 bearing a tyrosine-based activation motif is involved in activating NK cells.
8662091 1996 Alternatively spliced forms of human killer inhibitory receptors.
8627176 1996 The human leukocyte antigen (HLA)-C-specific "activatory" or "inhibitory" natural killer cell receptors display highly homologous extracellular domains but differ in their transmembrane and intracytoplasmic portions.
7749980 1995 Molecular clones of the p58 NK cell receptor reveal immunoglobulin-related molecules with diversity in both the extra- and intracellular domains.
7716543 1995 Cloning of immunoglobulin-superfamily members associated with HLA-C and HLA-B recognition by human natural killer cells.