Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Gene RIF (19)

PMID Text
26500342 We found the presence of KIR2DL5B to be associated with inferior transformation-free survival and event-free survival in patients with chronic phase-chronic myeloid leukemia
22652695 indicate that killer-cell immunoglobulin-like receptors (KIRs)activator (KIR3DS1 and KIR2DS5) and inhibitory (KIR2DL5) genes are associated with severe pandemic influenza A (H1N1) 2009 infections.
21729574 KIR2DL3, KIR2DS5 and KIR2DL5B genes may be correlated with pathogenesis of nasopharyngeal carcinoma in the Chinese southern Han population.
20878400 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
19761533 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19450876 Observational study of gene-disease association. (HuGE Navigator)
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
18498296 Alleles commonly found in a Northern Irish population of 354 individuals were KIR2DL5A*001, KIR2DL5A*005, and KIR2DL5B*002.
18461314 Promoter variants of KIR2DL5 add to diversity and may impact gene expression.
17215859 Observational study of gene-disease association. (HuGE Navigator)
17215859 Association of KIR2DL5B gene with celiac disease supports the susceptibility locus on 19q13.4.
16403292 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPE      1 - 70
LYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENV     71 - 140
ALSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDP    141 - 210
LLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQGPAGD    211 - 280
RTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQAL    281 - 350
RGSSRETTALSQNRVASSHVPAAGI                                                 351 - 375
//

Text Mined References (24)

PMID Year Title
26500342 2015 KIR2DL5B genotype predicts outcomes in CML patients treated with response-directed sequential imatinib/nilotinib strategy.
22652695 2012 Killer-cell immunoglobulin-like receptors (KIR) in severe A (H1N1) 2009 influenza infections.
21729574 2011 [Correlation of killer immunoglobulin-like receptor gene diversity with nasopharyngeal carcinoma in Chinese southern Han population].
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
18498296 2008 Investigation of killer cell immunoglobulin-like receptor (KIR) gene diversity: KIR2DL2, KIR2DL5 and KIR2DS5.
18461314 2008 Promoter variants of KIR2DL5 add to diversity and may impact gene expression.
17215859 2007 Association of KIR2DL5B gene with celiac disease supports the susceptibility locus on 19q13.4.
16403292 2005 [Polymorphism of killer cell immunoglobulin-like receptors gene family in Zhejiang Han population].
15496913 2004 Finishing the euchromatic sequence of the human genome.
12185535 2002 Some human KIR haplotypes contain two KIR2DL5 genes: KIR2DL5A and KIR2DL5B.
11237011 2001 Initial sequencing and analysis of the human genome.
11086080 2000 Gene structure and promoter variation of expressed and nonexpressed variants of the KIR2DL5 gene.
10820258 2000 KIR2DL5, a novel killer-cell receptor with a D0-D2 configuration of Ig-like domains.