Property Summary

NCBI Gene PubMed Count 160
PubMed Score 147.27
PubTator Score 171.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 8.0e-04
Disease Target Count Z-score Confidence
Cancer 2388 3.229 1.6
Hepatitis C 90 3.076 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 8.0e-04

Gene RIF (141)

AA Sequence

MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQ    211 - 280
EPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP             281 - 341
//

Text Mined References (160)

PMID Year Title