Property Summary

NCBI Gene PubMed Count 146
PubMed Score 0.00
PubTator Score 24.78

Knowledge Summary

Patent

No data available

Gene RIF (142)

PMID Text
26542066 KIR2DL2/2DS2-C1C1 genotype is associated with type 1 diabetes in Saudi children
26430804 Single Nucleotide Polymorphism in KIR2DL2 gene is associated with Asthma and Atopic Dermatitis.
26423800 Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population.
26202659 a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found.
26031759 genetic association study in population in Eastern India: Data suggest that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) contribute significantly toward susceptibility and protection toward type 1 diabetes.
25636579 genetic polymorphism is associated with chronic hepatitis C and levels of viremia in Poland
25575065 KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population.
25359276 KIR2DL3-positive NK cells were more sensitive to changes in the peptide content of MHC class I than KIR2DL2-positive NK cells.
25329633 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
25188020 Authors showed an increase in HLA-C1/KIR2DL2 and HLA-C1/KIR2DL3 pairs in human papillomavirus high-risk infected patients (OR 3.05, 3.24) with invasive cervical cancer (OR 1.33, 3.68).
25037176 We investigated the association of HLA alleles and KIR ligands according to oligoclonal band status in multiple sclerosis patients.
24839813 Different expression levels of KIR2DL2 may contribute to the abnormal function of natural killer (NK) and NKT lymphocytes, which lead to the risk of systemic lupus erythematosus (SLE) susceptibility.
24785948 These data show that naturally occurring sequence variations within HLA-C03:04-restricted HIV-1 p24 Gag epitopes can have a significant impact on the binding of inhibitory KIR2DL2 receptors and primary natural killer cell function.
24785948 HIV-1 Gag peptides (Gag144-152, Gag163-171 and Gag295-304) enhance binding of KIR2DL2 to HLA-C03:04 and result in inhibition of KIR2DL2+ primary NK cells
24755350 The strongest association for the development of epithelial ovarian cancer has been found between KIR2DL2 and HLA-C1 expression.
24735502 The results of this study confirmed a possible effect of KIR2DL2 on viral infection susceptibility in multiple sclerosis patients.
24651768 HLA-C genotypes are important determinants of conjunctival scarring in trachoma and that KIR2DL2/KIR2DL3 heterozygosity further increases risk of conjunctival scarring in individuals carrying HLA-C2.
24349500 combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene are predictive of the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV.
24122895 Authors showed a significant increased correlation between KIR2DL2/DS2, type 2 diabetes and HLA-C1C1 genotype in the type 2 diabetes patients infected with human herpesvirus 8.
23686481 the most common KIR2DL2/3 allelic products in European American and African American populations were evaluated
23380384 Data indicate that increased frequency of the activating receptor KIR2DS1 and a reduced frequency of the KIR-ligand combination KIR2DS2/2DL2 absent/C1 present were significantly associated with chronic myeloid leukemia (CML).
22960345 presence of KIR2DL2 is associated with rheumatoid arthritis.
22871633 The results are the first direct proof of the implication of KIR2DL2 receptor in the control of natural killer cell activation towards herpes virus infection in multiple sclerosis.
22836042 individuals possessing KIR2DL2 and/or KIR2DS2 (and, in most cases, also KIR2DL1) gene but no HLA-C C2 ligand may respond better to treatment and survive longer than people bearing other genotypes.
22807681 Engagement of KIR2DL2 might protect virus-infected cells from NK cell-mediated lysis and selections of sequence polymorphisms that increase avidity to KIR2DL2 might provide a mechanism for HIV-1 to escape NK cell-mediated immune pressure.
22807681 HIV-1 Gag peptides (Gag144-152, Gag163-171 and Gag295-304) enhance binding of KIR2DL2 to HLA-C03:04 and result in inhibition of KIR2DL2+ primary NK cells
22772445 Amino acid variation at positions 68, 70, and 182 modulates the binding avidity of KIR2DL for histocompatibility antigen HLA-C compared to KIR2DL3.
22715396 these results suggest that inhibitory KIR2DL2 and KIR2DL3, which are alleles of the same locus, play a role in the inverse effects on PM and PM/HIV co-infection
22024796 In a comparison of healthy controls and a tightly defined cohort of adult ITP patients, the KIR2DS2/KIR2DL2 genotype was found to be associated with ITP independently of FCGR3a-158 polymorphisms.
22022261 in two unrelated viral infections, hepatitis C virus and human T lymphotropic virus type 1, possession of the KIR2DL2 gene enhanced both protective and detrimental HLA class I-restricted anti-viral immunity.
21814282 HIV-1 Gag peptides (Gag144-152, Gag163-171 and Gag295-304) enhance binding of KIR2DL2 to HLA-C03:04 and result in inhibition of KIR2DL2+ primary NK cells
21373785 KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy.
20935224 Observational study of gene-disease association. (HuGE Navigator)
20878400 Observational study of gene-disease association. (HuGE Navigator)
20875478 We report four novel KIR2DL2 alleles and two novel KIR2DL3 alleles identified from an East African population using sequence-based typing.
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20371502 Observational study of gene-disease association. (HuGE Navigator)
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20207982 Single nucleotide polymorphism in KIR2DL2 gene is associated with posttransplantation non-Hodgkin lymphoma.
20207982 Observational study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20082646 Observational study of genotype prevalence. (HuGE Navigator)
20082621 Observational study of gene-disease association. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
20056126 Data show that KIR activation and HLA expression density are critical determinants for the efficacy of rituximab treatment.
19968064 Observational study of gene-disease association. (HuGE Navigator)
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19926642 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19897003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19877200 Absence of KIR2DS2 and/or KIR2DL2 is associated with failure of antiviral therapy in patients with recurrent hepatitis C after liver transplantation
19877200 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19875891 Observational study of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19789864 The KIR2DL2, KIR2DL3 genotype is predisposing to Crohn's disease in the presence of C1 ligand.
19761533 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19664392 Observational study of gene-disease association. (HuGE Navigator)
19630074 Observational study of gene-disease association. (HuGE Navigator)
19552960 Findings in HCV-infected and non-infected IDUs suggest an important role for KIRs (KIR2DL2 and KIR2DL3) with group HLA-C1 molecules, in the presence of activating KIR2DS4, in protection from HCV infection.
19552960 Observational study of gene-disease association. (HuGE Navigator)
19549382 DNA-demethylating treatment with 5-azacytidine resulted in re-expression of kir2DL1 gene and increased expressions of kir2DL1, kir2DL2 and kir2DL3 genes in NK-92MI cells.
19527230 Observational study of gene-disease association. (HuGE Navigator)
19522772 Observational study of genetic testing. (HuGE Navigator)
19493232 a model in chronic myeloid leukemia of protection via KIR2DL2 and/or KIR2DS2 with the presence of the ligand HLA-C1 group and susceptibility via HLA-Bw4 homozygosity (i.e. absence of HLA-Bw6) was proposed.
19493232 Observational study of gene-disease association. (HuGE Navigator)
19489269 Observational study of gene-disease association. (HuGE Navigator)
19450876 Observational study of gene-disease association. (HuGE Navigator)
19421224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19392800 The inhibition of NK-cell cytotoxicity may be impaired in individuals carrying the rs2756923 G allele. These data suggest a potential role of the KIR2DL2-rs2756923 polymorphism in Type I Deabetes in Germans and Belgians.
19392800 Observational study of gene-disease association. (HuGE Navigator)
19326408 Observational study of gene-disease association. (HuGE Navigator)
19309280 Observational study of gene-disease association. (HuGE Navigator)
19279038 Observational study of gene-disease association. (HuGE Navigator)
19234149 Natural killer (NK) cells in a humanized mouse model express multiple killer inhibitory receptors in a stochastic manner, including HLA-Cw3-specific inhibitory receptor KIR2DL2; these mice reject wild-type mouse spleen cells upon intravenous injection.
19218127 Observational study of genotype prevalence. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
19046302 a combination KIR2DL2- HLA-C1 plays a critical role in susceptibility or protection in Latvians against type 1 diabetes.
19032228 Observational study of gene-disease association. (HuGE Navigator)
19000141 Observational study of genotype prevalence. (HuGE Navigator)
18945962 Observational study of gene-disease association. (HuGE Navigator)
18945643 The role of DNA methylation in regulating of the genes, KIR2DL2 and KIR2DL4, was characterized;these genes are normally suppressed in part by promoter methylation in non-expressing T cells.
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18830515 Observational study of genotype prevalence. (HuGE Navigator)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18755860 Observational study of gene-disease association. (HuGE Navigator)
18687225 Observational study of gene-disease association. (HuGE Navigator)
18681957 Observational study of gene-disease association. (HuGE Navigator)
18668235 Observational study of genotype prevalence. (HuGE Navigator)
18643961 Observational study of gene-disease association. (HuGE Navigator)
18572300 increased frequency in recurrent spontaneous abortion group
18571006 Observational study of gene-disease association. (HuGE Navigator)
18543232 Observational study of genotype prevalence. (HuGE Navigator)
18498296 Allele typing data support the view that KIR2DL2 and KIR2DL3 are alleles of the same gene.
18322206 Allelic polymorphism at sites distal to the ligand-binding site of KIR2DL2 has diversified this receptor's interactions with HLA-C; the interaction between the HLA-C epitope and KIR2DL2 strongly inhibits natural killer cell cytotoxicity.
18292496 In contrast to natural killer (NK) cells, the functions of killer inhibitory receptors in CD4+ T lymphocytes might derive from a selective expression of their activating or inhibiting (CD158b1) forms.
18269867 Observational study of gene-disease association. (HuGE Navigator)
18091530 Observational study of gene-disease association. (HuGE Navigator)
17882223 Observational study of gene-disease association. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17498266 Observational study of genotype prevalence. (HuGE Navigator)
17445184 Observational study of gene-disease association. (HuGE Navigator)
17445184 Lack of KIR2DL2 is associated with poor graft function
17200871 Observational study of genotype prevalence. (HuGE Navigator)
16929347 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16774542 Observational study of genotype prevalence. (HuGE Navigator)
16698433 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16698429 Observational study of genotype prevalence. (HuGE Navigator)
16571411 Observational study of gene-disease association. (HuGE Navigator)
16469873 KIRs on memory T cells operate to uncouple effector functions by modifying the transcriptional profile while leaving granule exocytosis unabated.
16403292 Observational study of genotype prevalence. (HuGE Navigator)
16112031 Observational study of gene-disease association. (HuGE Navigator)
15896204 Observational study of genotype prevalence. (HuGE Navigator)
15879158 Observational study of gene-disease association. (HuGE Navigator)
15848530 Because few factors interfere with the expression of CD158b on natural killer cells, monitoring of this marker may be accurate and sensitive after kidney transplantation.
15730517 Observational study of gene-disease association. (HuGE Navigator)
15699512 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15699512 KIR2DL2 is positively associated with diabetes mellitus, type 1.
15248031 Observational study of gene-disease association. (HuGE Navigator)
15146426 The genetic combination of KIR2DS2+ and KIR2DL2- is associated with scleroderma.
15140215 Observational study of gene-disease association. (HuGE Navigator)
12559621 Individuals were subgrouped according to the major HLA-C encoded KIR-epitopes (group C1 versus C2). C2 individuals transcribe RNA from KIR2DL2 genes without specific HLA-C ligands.
12121272 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQE    211 - 280
SAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP      281 - 348
//

Text Mined References (146)

PMID Year Title
26542066 2016 Investigation of activating and inhibitory killer cell immunoglobulin-like receptors and their putative ligands in type 1 diabetes (T1D).
26430804 2015 Imputation of KIR Types from SNP Variation Data.
26423800 2015 Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population.
26202659 2015 Increased frequencies of the killer immunoglobulin-like receptor genes KIR2DL2 and KIR2DS2 are associated with neuroblastoma.
26031759 2016 Killer immunoglobulin receptor genes and their HLA-C ligand are associated with Type 1 diabetes in an Eastern Indian population.
25636579 2015 Contribution of genes for killer cell immunoglobulin-like receptors (KIR) to the susceptibility to chronic hepatitis C virus infection and to viremia.
25575065 2015 [Correlation analysis between killer cell immunoglobulin-like receptor gene polymorphism and primary biliary cirrhosis].
25359276 2015 Peptide selectivity discriminates NK cells from KIR2DL2- and KIR2DL3-positive individuals.
25329633 2014 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
25188020 2014 Implication of HLA-C and KIR alleles in human papillomavirus infection and associated cervical lesions.
25037176 2014 Oligoclonal band phenotypes in MS differ in their HLA class II association, while specific KIR ligands at HLA class I show association to MS in general.
24839813 2014 The aberrant expression of stimulatory and inhibitory killer immunoglobulin-like receptors in NK- and NKT-cells contributes to lupus.
24785948 2014 Sequence variations in HIV-1 p24 Gag-derived epitopes can alter binding of KIR2DL2 to HLA-C*03:04 and modulate primary natural killer cell function.
24755350 2014 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with epithelial ovarian cancer.
24735502 2014 Evaluation of the implication of KIR2DL2 receptor in multiple sclerosis and herpesvirus susceptibility.
24651768 2014 Conjunctival scarring in trachoma is associated with the HLA-C ligand of KIR and is exacerbated by heterozygosity at KIR2DL2/KIR2DL3.
24349500 2013 KIR, HLA, and IL28B variant predict response to antiviral therapy in genotype 1 chronic hepatitis C patients in Japan.
24122895 2014 High prevalence of HHV8 infection and specific killer cell immunoglobulin-like receptors allotypes in Sardinian patients with type 2 diabetes mellitus.
23686481 2013 Allelic variation in KIR2DL3 generates a KIR2DL2-like receptor with increased binding to its HLA-C ligand.
23380384 2013 Homozygosity for killer immunoglobin-like receptor haplotype A predicts complete molecular response to treatment with tyrosine kinase inhibitors in chronic myeloid leukemia patients.
22960345 2012 Associations of killer cell immunoglobulin- like receptor genes with rheumatoid arthritis.
22871633 2012 Altered natural killer cells' response to herpes virus infection in multiple sclerosis involves KIR2DL2 expression.
22836042 2012 KIR2DL2/S2 and HLA-C C1C1 genotype is associated with better response to treatment and prolonged survival of patients with non-small cell lung cancer in a Polish Caucasian population.
22807681 2012 HLA-Cw*0102-restricted HIV-1 p24 epitope variants can modulate the binding of the inhibitory KIR2DL2 receptor and primary NK cell function.
22772445 2012 Mutation at positively selected positions in the binding site for HLA-C shows that KIR2DL1 is a more refined but less adaptable NK cell receptor than KIR2DL3.
22715396 2012 Differential association of gene content polymorphisms of killer cell immunoglobulin-like receptors with placental malaria in HIV- and HIV+ mothers.
22024796 2012 The KIR2DS2/DL2 genotype is associated with adult persistent/chronic and relapsed immune thrombocytopenia independently of FCGR3a-158 polymorphisms.
22022261 2011 KIR2DL2 enhances protective and detrimental HLA class I-mediated immunity in chronic viral infection.
21373785 2012 Killer immunoglobulin-like receptor and human leukocyte antigen-C genotypes in rheumatoid arthritis primary responders and non-responders to anti-TNF-? therapy.
21206914 2010 Different patterns of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus.
20935224 2010 Genotypes of NK cell KIR receptors, their ligands, and Fc? receptors in the response of neuroblastoma patients to Hu14.18-IL2 immunotherapy.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20875478 2010 Identification of four novel KIR2DL2 alleles and two novel KIR2DL3 alleles in an East African population.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20371502 2010 Association of killer cell immunoglobulin-like receptor 2DL5 with systemic lupus erythematosus and accompanying infections.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20207982 2010 Natural killer-cell receptor polymorphisms and posttransplantation non-Hodgkin lymphoma.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20082646 2010 Killer cell immunoglobulin-like receptor gene diversity in a Caucasian population of southern Brazil.
20082621 2010 Killer cell immunoglobulin-like receptor (KIR) genes in systemic sclerosis.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
20056126 2010 B-lymphoma cells escape rituximab-triggered elimination by NK cells through increased HLA class I expression.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19959527 2010 Mechanisms of copy number variation and hybrid gene formation in the KIR immune gene complex.
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19926642 2010 Disparate distribution of activating and inhibitory killer cell immunoglobulin-like receptor genes in patients with systemic lupus erythematosus.
19897003 2010 Killer cell immunoglobulin-like receptor gene-cluster 3DS1-2DL5-2DS1-2DS5 predisposes susceptibility to Vogt-Koyanagi-Harada syndrome in Japanese individuals.
19877200 2009 Lack of killer immunoglobulin-like receptor 2DS2 (KIR2DS2) and KIR2DL2 is associated with poor responses to therapy of recurrent hepatitis C virus in liver transplant recipients.
19875891 2009 Frequencies of killer immunoglobulin-like receptor genotypes influence susceptibility to spontaneous abortion.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19789864 2009 Susceptibility to Crohn's disease is mediated by KIR2DL2/KIR2DL3 heterozygosity and the HLA-C ligand.
19761533 2009 Distribution of killer-cell immunoglobulin-like receptor genes in Eastern mainland Chinese Han and Taiwanese Han populations.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19664392 2009 [Genotype analysis of killer cell immunoglobulin-like receptors in Graves' disease patients].
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19552960 2009 Protective KIR-HLA interactions for HCV infection in intravenous drug users.
19549382 2009 [Effect of demethylation treatment on the expression of inhibitory receptor KIR gene in NK-92MI cell line].
19527230 2009 Activating killer cell immunoglobulin-like receptor genes' association with recurrent miscarriage.
19522772 2009 High-throughput genotyping of KIR2DL2/L3, KIR3DL1/S1, and their HLA class I ligands using real-time PCR.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19489269 2009 [Genotype and haplotype analysis of killer cell immunoglobulin-like receptors in ankylosing spondylitis].
19450876 2010 Killer cell immunoglobulin-like receptor gene polymorphisms in patients with leukemia: possible association with susceptibility to the disease.
19421224 2009 Multiple sclerosis associates with LILRA3 deletion in Spanish patients.
19392800 2009 Association of KIR2DL2 polymorphism rs2756923 with type 1 diabetes and preliminary evidence for lack of inhibition through HLA-C1 ligand binding.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19309280 2009 Distribution of killer cell immunoglobulin-like receptor (KIR) genotypes in patients with familial Mediterranean fever.
19279038 2009 Influence of activating and inhibitory killer immunoglobulin-like receptors on predisposition to recurrent miscarriages.
19234149 2009 Cutting edge: killer Ig-like receptors mediate "missing self" recognition in vivo.
19218127 2009 [Analysis of natural killer cell immunoglobulin-like receptor genes in Chinese].
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
19000141 2009 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Java, Kalimantan, Timor and Irian Jaya.
18945962 2009 Donors with group B KIR haplotypes improve relapse-free survival after unrelated hematopoietic cell transplantation for acute myelogenous leukemia.
18945643 2009 DNA methylation inhibition increases T cell KIR expression through effects on both promoter methylation and transcription factors.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of ParanĂ¡.
18830515 2008 Natural killer cells and immune surveillance.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18759923 2008 The extended human leukocyte receptor complex: diverse ways of modulating immune responses.
18755860 2008 Association of killer cell immunoglobulin-like receptor genotypes with vascular arterial events and anticardiolipin antibodies in patients with lupus.
18687225 2008 [Study on the polymorphism of killer cell immunoglobulin like receptor (KIR) gene with systemic lupus erythematosus of North population in China].
18681957 2008 NullHap--a versatile application to estimate haplotype frequencies from unphased genotypes in the presence of null alleles.
18668235 2008 Asian population frequencies and haplotype distribution of killer cell immunoglobulin-like receptor (KIR) genes among Chinese, Malay, and Indian in Singapore.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18572300 2008 Killer immunoglobulin-like receptor repertoire on uterine natural killer cell subsets in women with recurrent spontaneous abortions.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18543232 2008 [Analysis of HLA-Cw, KIR2D genetic variations in 2 Chinese populations].
18498296 2008 Investigation of killer cell immunoglobulin-like receptor (KIR) gene diversity: KIR2DL2, KIR2DL5 and KIR2DS5.
18322206 2008 Synergistic polymorphism at two positions distal to the ligand-binding site makes KIR2DL2 a stronger receptor for HLA-C than KIR2DL3.
18292496 2008 Cutting edge: selective expression of inhibitory or activating killer cell Ig-like receptors in circulating CD4+ T lymphocytes.
18269867 2007 [Distribution of immunoglobulin like receptor gene in Han population in China and the impact thereof on the HLA-identical sibling hematopoietic stem cell transplantation].
18091530 2007 KIR/HLA ligand incompatibility in kidney transplantation.
17882223 2007 Associations of killer cell immunoglobulin-like receptor genes with complications of rheumatoid arthritis.
17868255 2007 No association of KIR genes with Behcet's disease.
17498266 2007 KIR genes polymorphism in Argentinean Caucasoid and Amerindian populations.
17445184 2007 Killer cell immunoglobulin-like receptor polymorphisms in HLA-identical kidney transplant recipients: lack of 2DL2 and 2DS2 may be associated with poor graft function.
17200871 2007 KIR haplotype content at the allele level in 77 Northern Irish families.
17092261 2006 The LRC haplotype project: a resource for killer immunoglobulin-like receptor-linked association studies.
16929347 2006 Killer Ig-like receptor (KIR) genotype and HLA ligand combinations in ulcerative colitis susceptibility.
16774542 2006 Distribution of killer cell immunoglobulin-like receptors genotypes in the Lebanese population.
16698433 Killer cell immunoglobulin-like receptor (KIR) genes in the Basque population: association study of KIR gene contents with type 1 diabetes mellitus.
16698429 KIR gene in ethnic and Mestizo populations from Mexico.
16571411 2005 HLA-C and KIR genes in hepatitis C virus infection.
16469873 2006 Uncoupling of T-cell effector functions by inhibitory killer immunoglobulin-like receptors.
16403292 2005 [Polymorphism of killer cell immunoglobulin-like receptors gene family in Zhejiang Han population].
16112031 2005 Activating killer cell immunoglobulin-like receptor gene KIR2DS1 is associated with psoriatic arthritis.
15896204 2005 Distribution of killer cell immunoglobulin-like receptor genes in the Chinese Han population.
15879158 2005 Comparison of killer Ig-like receptor genotyping and phenotyping for selection of allogeneic blood stem cell donors.
15848530 2005 Expression of CD158b on peripheral blood lymphocytic cell after kidney transplantation.
15730517 2005 A population-based cohort study of KIR genes and genotypes in relation to cervical intraepithelial neoplasia.
15699512 2004 Killer cell immunoglobulin-like receptor genes in Latvian patients with type 1 diabetes mellitus and healthy controls.
15248031 2005 Genetic polymorphism of NK receptors and their ligands in melanoma patients: prevalence of inhibitory over activating signals.
15146426 2004 Association of killer cell immunoglobulin-like receptors with scleroderma.
15140215 2004 Genetic polymorphisms of killer cell immunoglobulin-like receptors are associated with susceptibility to psoriasis vulgaris.
14607943 2003 Activation of a subset of human NK cells upon contact with Plasmodium falciparum-infected erythrocytes.
12559621 2003 Assessment of killer cell immunoglobulinlike receptor expression and corresponding HLA class I phenotypes demonstrates heterogenous KIR expression independent of anticipated HLA class I ligands.
12473268 2002 Expression of p58.2 or CD94/NKG2A inhibitory receptors in an NK-like cell line, YTINDY, leads to HLA Class I-mediated inhibition of cytotoxicity in the p58.2- but not the CD94/NKG2A-expressing transfectant.
12121272 2002 Analysis of candidate genes on chromosome 19 in coeliac disease: an association study of the KIR and LILR gene clusters.
11750651 2002 Inhibition of CD28-mediated natural cytotoxicity by KIR2DL2 does not require p56(lck) in the NK cell line YT-Indy.
11169255 2001 Identification of seventeen novel KIR variants: fourteen of them from two non-Caucasian donors.
10850706 2000 Crystal structure of an NK cell immunoglobulin-like receptor in complex with its class I MHC ligand.
10190900 1999 A human histocompatibility leukocyte antigen (HLA)-G-specific receptor expressed on all natural killer cells.
10097129 1999 Crystal structure of the HLA-Cw3 allotype-specific killer cell inhibitory receptor KIR2DL2.
9476117 1997 The C1q and collectin binding site within C1q receptor (cell surface calreticulin).
8662091 1996 Alternatively spliced forms of human killer inhibitory receptors.
7749980 1995 Molecular clones of the p58 NK cell receptor reveal immunoglobulin-related molecules with diversity in both the extra- and intracellular domains.