Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.54
PubTator Score 15.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.8e-05
osteosarcoma 7933 1.4e-04
Disease Target Count Z-score Confidence
Progressive muscular atrophy 6 3.601 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.800 1.8e-05
osteosarcoma 2.146 1.4e-04

Gene RIF (6)

PMID Text
25253721 Data indicate that E-cadherin ubiquitination consistently increases after depletion of kinesin-like protein KIFC3 or ubiquitin-specific protease USP47.
24275865 KIFC3 may guide free microtubules to their destination at the bridge and/or may slide and crosslink central bridge microtubules in order to stage the cells for abscission.
23954441 KifC3 may play a regulatory role in minus-end directed peroxisomal transport for example by blocking the motor function of dynein at peroxisomes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19789344 High expression of KIFC3 is associated with docetaxel resistance in breast cancer.

AA Sequence

MVPSRRTWNLGATPSLRGLWRVGRAPEPEPGMARPAPAPASPAARPFPHTGPGRLRTGRGKDTPVCGDED      1 - 70
SSARSAARPALAQCRALSVDWAGPGSPHGLYLTLQVEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLM     71 - 140
VENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLSQLQLEMAESKGMLSELNLEVQQKTD    141 - 210
RLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQ    211 - 280
HLQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQIAMYESELERAHGQMLEEMQSLEEDKNRAIEEAFARA    281 - 350
QVEMKAVHENLAGVRTNLLTLQPALRTLTNDYNGLKRQVRGFPLLLQEALRSVKAEIGQAIEEVNSNNQE    351 - 420
LLRKYRRELQLRKKCHNELVRLKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSF    421 - 490
ELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQ    491 - 560
EKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGH    561 - 630
TNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKS    631 - 700
LSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVEL    701 - 770
GPGLRRAELGSWSSQEHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV           771 - 833
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25253721 2014 Minus end-directed motor KIFC3 suppresses E-cadherin degradation by recruiting USP47 to adherens junctions.
24275865 2014 KIFC3 promotes mitotic progression and integrity of the central spindle in cytokinesis.
23954441 2013 Identification of the kinesin KifC3 as a new player for positioning of peroxisomes and other organelles in mammalian cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19789344 2009 Overexpression of kinesins mediates docetaxel resistance in breast cancer cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19041755 2008 Anchorage of microtubule minus ends to adherens junctions regulates epithelial cell-cell contacts.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135985 2002 Role of KIFC3 motor protein in Golgi positioning and integration.
11581287 2001 KIFC3, a microtubule minus end-directed motor for the apical transport of annexin XIIIb-associated Triton-insoluble membranes.
10375449 1999 Characterization of a novel C-kinesin (KIFC3) abundantly expressed in vertebrate retina and RPE.
9782090 1998 Cloning of a novel C-terminal kinesin (KIFC3) that maps to human chromosome 16q13-q21 and thus is a candidate gene for Bardet-Biedl syndrome.
8240664 1993 Limited T-cell receptor diversity in liver-infiltrating lymphocytes from patients with primary biliary cirrhosis.