Property Summary

NCBI Gene PubMed Count 25
PubMed Score 78.36
PubTator Score 44.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.400 5.9e-07
glioblastoma 1.600 2.2e-04
medulloblastoma 2.000 2.5e-07
atypical teratoid / rhabdoid tumor 1.500 1.4e-09
medulloblastoma, large-cell 1.800 1.5e-05
primitive neuroectodermal tumor 1.700 3.1e-06
non-small cell lung cancer 1.075 1.5e-19
lung cancer 1.800 4.0e-04
pediatric high grade glioma 1.100 1.6e-04
ovarian cancer 1.200 2.1e-08
psoriasis 1.300 1.9e-63

Gene RIF (16)

PMID Text
26992853 Association of KIFC1 gene expression and centrosome amplification with high-grade serous ovarian carcinoma.
26987684 stabilization of the centrosome-spindle pole interface by the CEP215-HSET complex could promote survival of cancer cells containing supernumerary centrosomes.
26177331 KIFC1 silencing significantly reduces breast cancer cell viability.
25788277 Data provides the first evidence of centrosome clustering-independent activities of HSET that fuel tumor progression.
25028599 Our data underscore KIFC1 as a putative biomarker that predicts worse prognosis, poor overall survival and may serve as a potential marker of onset of metastatic dissemination in ovarian cancer patients.
24857844 We show that some are new substrates of the anaphase-promoting complex/cyclosome and validate KIFC1 and RacGAP1/Cyk4 as two such targets involved respectively in timely mitotic spindle disassembly and cell spreading
24039245 Study demonstrates microtubule tip-tracking of human kinesin-14 HSET and show that EB1 is sufficient to induce this dynamic microtubule end localization.
23318213 we suggest that KIFC1 plays an essential role for bipolar MTOC formation and maintaining chromosomal stability in the mitosis .
22946058 Acentrosomal spindle assembly mechanisms are hyperactive in cancer cells and promote HSET.
22201025 A case-control analysis was carried out by comparing the genotype distribution of six KIFC1 single-nucleotide polymorphisms between 93 aspirin exacerbated respiratory disease cases and 96 aspirin-tolerant asthma controls in a Korean population
19851445 Observational study of gene-disease association. (HuGE Navigator)
19679349 The intense placental expression of KIFC1 in syncytiotrophoblast and KIF17 in vascular endothelium suggests that both proteins might be important in a cargo-transport system. KIFC1 and KIF17 expression are increased of both in preeclamptia and diabetes.
19525938 Chromosome congression in HSET + hNuf2 co-depleted cells required the plus-end directed motor CENP-E , which has been implicated in the gliding of mono-oriented kinetochores alongside adjacent K-fibres.
19190132 High KIFC1 expression is associated with metastatic spread to the brain in primary non-small cell lung cancer.
19116309 HSET has a role in controlling spindle length by cross-linking and sliding microtubules.
17326138 An analysis was made of the weak interactions of ADP-Unc104 and ADP-kinesin with microtubules and their inhibition by MAP2.

AA Sequence

MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVP      1 - 70
SLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTSGVPPMAGGKKPSKRPAWDLK     71 - 140
GQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLR    141 - 210
ACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQA    211 - 280
ALLTEREERLHGLEMERRRLHNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSL    281 - 350
SRSDERRGTLSGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM    351 - 420
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRA    421 - 490
GPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAP    491 - 560
LSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKLTYLLQNSLGG    561 - 630
SAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQANRK                               631 - 673
//

Text Mined References (29)

PMID Year Title
26992853 2016 A centrosome clustering protein, KIFC1, predicts aggressive disease course in serous ovarian adenocarcinomas.
26987684 2016 A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer.
26177331 2015 KIFC1 is a novel potential therapeutic target for breast cancer.
25788277 2015 HSET overexpression fuels tumor progression via centrosome clustering-independent mechanisms in breast cancer patients.
25028599 2014 KIFCI, a novel putative prognostic biomarker for ovarian adenocarcinomas: delineating protein interaction networks and signaling circuitries.
24857844 2014 Using in vivo biotinylated ubiquitin to describe a mitotic exit ubiquitome from human cells.
24039245 2013 The human kinesin-14 HSET tracks the tips of growing microtubules in vitro.
23318213 2013 KIFC1 is essential for bipolar spindle formation and genomic stability in the primary human fibroblast IMR-90 cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22946058 2012 Acentrosomal spindle organization renders cancer cells dependent on the kinesin HSET.
22201025 2012 Genetic variations in KIFC1 and the risk of aspirin exacerbated respiratory disease in a Korean population: an association analysis.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19679349 2009 The presence of kinesin superfamily motor proteins KIFC1 and KIF17 in normal and pathological human placenta.
19525938 2009 Chromosome congression in the absence of kinetochore fibres.
19190132 2009 The expression of three genes in primary non-small cell lung cancer is associated with metastatic spread to the brain.
19116309 2009 Kinesin-14 family proteins HSET/XCTK2 control spindle length by cross-linking and sliding microtubules.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17326138 2007 Analysis of the weak interactions of ADP-Unc104 and ADP-kinesin with microtubules and their inhibition by MAP2c.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15843429 2005 Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416179 2001 All kinesin superfamily protein, KIF, genes in mouse and human.
10369922 1999 Genomic organization of the HSET locus and the possible association of HLA-linked genes with immotile cilia syndrome (ICS).
8276466 1994 Cloning of a new kinesin-related gene located at the centromeric end of the human MHC region.