Property Summary

NCBI Gene PubMed Count 30
PubMed Score 24.13
PubTator Score 24.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -1.288 3.1e-02
acute myeloid leukemia -1.900 3.9e-02
adult high grade glioma -1.100 1.6e-04
atypical teratoid / rhabdoid tumor -1.100 2.4e-04
medulloblastoma, large-cell -1.300 1.4e-04
ovarian cancer -1.600 4.1e-08
Pick disease -1.400 2.8e-04

 GO Function (1)

Gene RIF (14)

AA Sequence

MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSL      1 - 70
ARKVVEECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPPFEGMEIDEVANINDMDEYIE     71 - 140
LLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIFFCFSSFSQF    141 - 210
HGLITHYKIGALCMNIIDHELKRHELWQEELSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLR    211 - 280
VALYLLLNLAEDTRTELKMRNKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLV    281 - 350
KMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMF    351 - 420
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKFKDPLLMKMIRNI    421 - 490
SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAA    491 - 560
EDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIK    561 - 630
ETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLY    631 - 700
GDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGI    701 - 770
LGRPATAYGFRPDEPYYYGYGS                                                    771 - 792
//

Text Mined References (34)

PMID Year Title