Property Summary

NCBI Gene PubMed Count 48
PubMed Score 38.41
PubTator Score 48.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myocardial Infarction 151 0.0 0.0
Disease Target Count P-value
ependymoma 4679 5.1e-05
medulloblastoma, large-cell 6241 1.3e-04
subependymal giant cell astrocytoma 2287 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Large intestine cancer 126 0.0 0.7
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.4
Disease Target Count Z-score Confidence
Coronary artery disease 268 4.341 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.400 5.1e-05
medulloblastoma, large-cell 1.100 1.3e-04
subependymal giant cell astrocytoma -1.010 2.5e-02

Protein-protein Interaction (5)

Gene RIF (40)

AA Sequence

MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQ      1 - 70
ETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYT     71 - 140
THISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRM    141 - 210
IAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYL    211 - 280
EQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAV    281 - 350
LNEEINPRLVIKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK    351 - 420
VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQ    421 - 490
EALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQE    491 - 560
AFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQVALGISENMAVPL    561 - 630
MPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAV    631 - 700
NSLDHTKPFLQTSDSQHEWSQLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTP    701 - 770
LEDSIPKRPVSSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN                              771 - 814
//

Text Mined References (50)

PMID Year Title