Property Summary

NCBI Gene PubMed Count 41
PubMed Score 36.47
PubTator Score 48.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.400 4.2e-09
medulloblastoma, large-cell 1.100 1.3e-04
subependymal giant cell astrocytoma -1.010 2.5e-02

Protein-protein Interaction (5)

Gene RIF (38)

PMID Text
26443250 KIF6 polymorphism rs20455 had a significant association with Coronary Heart Disease; statin therapy was more effective in rs20455 carriers than non-carriers
25629058 KIF6 719Arg allele may increase the risk of T2DM and T2DM + CHD only in Han Chinese men by modulating lipid metabolism.
23236363 Our case-control study suggests that Trp719Arg of KIF6 gene is associated with coronary heart disease in female Han Chinese through a post hoc analysis.
23001387 KIF6 719Arg allele was not an independent risk factor for angiographic coronary artery disease(CAD)susceptibility in northern China Han populations; it was associated with a significantly higher TG level, which may indicate increased myocardial infarction risk in angiographic CAD patients
22819534 These data suggest that decreased availability of functional KLF6 contributes to clinical prostate cancer progression.
22216121 In a meta-analysis involving 144,931 participants, the KIF6 719Arg allele was not associated with the relative risk of cardiovascular disease
22192511 Assessment of KIF6 genotype is not useful in predicting low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
21943003 Discovered influence of polymorphic marker Trp719Arg of KIF6 gene on individual response to therapy with 10 mg/day of atorvastatin.
21871624 In patients with type 2 diabetes mellitus on hemodialysis, KIF6 Trp719Arg genotypes were not associated with adverse cardiovascular outcomes during follow-up or with the efficacy of atorvastatin therapy.
21810021 Carriers of the KIF6 719Arg allele were not at increased risk of CAD/non-fatal MI in a case-control study of Indians (Indo-Europeans) living in Western India.
21458191 Use of KIF6 genotyping to guide statin therapy is not warranted in this heart protection trial, since no impact is found on KIF6 genotype, vascular risk or statin response.
21406102 A combination of KIF6 719Arg carrier status and C-reactive protein levels modestly improves the prediction of risk of myocardial infarction among white men.
20933357 Meta-analysis of gene-disease association. (HuGE Navigator)
20933357 Kinesin-like protein-6 tryptophan719arginine polymorphism is not associated with risk of clinical coronary artery disease in this large replication study.
20927332 Carriers of the KIF6 719Arg allele were not at increased risk of non-fatal myocardial infarction.
20927332 Observational study of gene-disease association. (HuGE Navigator)
20886236 three highly linked SNPs in the KIF6 region were identified that predict differential reduction of coronary events from statin therapy.
20886236 Observational study and clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20854963 review of data supporting association between KIF6 polymorphism and coronary heart disease (CHD) and association between KIF6 polymorphism and event reduction by statin therapy; discuss putative biologic role of this kinesin in the cause of CHD [review]
20679960 Observational study of gene-disease association. (HuGE Navigator)
20659029 the role of polymorphic marker Thr719Arg of kinesin 6 gene in development of ischemic heart disease, myocardial infarction, and in efficacy of therapy with statins (Review)
20403483 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403483 pravastatin therapy significantly and substantially reduced primary end point events in carriers of the KIF6 719Arg allele but not in noncarriers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215968 Elderly carriers of the KIF6 719Arg variant with prior vascular disease received significant benefit from pravastatin therapy.
20215968 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20044086 a relationship between the presence of endothelial colony-forming cells and Arg/Arg genotype in KIF6 in patients with acute myocardial infarction.
19752551 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18510970 The KIF6 719Arg variant has been associated with an increased risk of coronary disease and an increased response to statin therapy.
18222355 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18222355 Carriers of 719Arg receive significantly greater benefit from intensive statin therapy than do noncarriers, a superior benefit that appears to be due to a mechanism distinct from lipid or CRP lowering.
18222354 Observational study of gene-disease association. (HuGE Navigator)
18222354 Confirming and extending previous reports, carriers of the 719Arg allele of KIF6 have 34% higher risk of myocardial infarction and 24% higher risk of CHD compared with noncarriers among 25,283 women from the WHS.
18222353 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18222353 In both the CARE and the WOSCOPS trials, carriers of the KIF6 719Arg allele had an increased risk of coronary events, and pravastatin treatment substantially reduced that risk.
18073581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQ      1 - 70
ETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYT     71 - 140
THISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRM    141 - 210
IAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYL    211 - 280
EQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAV    281 - 350
LNEEINPRLVIKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK    351 - 420
VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQ    421 - 490
EALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQE    491 - 560
AFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQVALGISENMAVPL    561 - 630
MPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAV    631 - 700
NSLDHTKPFLQTSDSQHEWSQLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTP    701 - 770
LEDSIPKRPVSSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN                              771 - 814
//

Text Mined References (43)

PMID Year Title
26443250 2015 Impact of KIF6 Polymorphism rs20455 on Coronary Heart Disease Risk and Effectiveness of Statin Therapy in 100 Patients from Southern Iran.
25629058 2014 Novel KIF6 polymorphism increases susceptibility to type 2 diabetes mellitus and coronary heart disease in Han Chinese men.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23236363 2012 Meta-analyses of KIF6 Trp719Arg in coronary heart disease and statin therapeutic effect.
23001387 2012 Association of KIF6 variant with lipid level and angiographic coronary artery disease events risk in the Han Chinese population.
22819534 2012 KLF6 loss of function in human prostate cancer progression is implicated in resistance to androgen deprivation.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22216121 2011 A common KIF6 polymorphism increases vulnerability to low-density lipoprotein cholesterol: two meta-analyses and a meta-regression analysis.
22192511 2012 KIF6, LPA, TAS2R50, and VAMP8 genetic variation, low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
21943003 2011 [Association of a polymorphic marker Trp719Arg of KIF6 gene with effects of atorvastatin and simvastatin in patients with early ischemic heart disease].
21871624 2011 Lack of association between the Trp719Arg polymorphism in kinesin-like protein-6 and cardiovascular risk and efficacy of atorvastatin among subjects with diabetes on dialysis: the 4D study.
21810021 2011 Investigation of KIF6 Trp719Arg in a case-control study of coronary artery disease in Western Indians.
21458191 2011 No impact of KIF6 genotype on vascular risk and statin response among 18,348 randomized patients in the heart protection study.
21406102 2011 The contribution of a 9p21.3 variant, a KIF6 variant, and C-reactive protein to predicting risk of myocardial infarction in a prospective study.
20933357 2010 Lack of association between the Trp719Arg polymorphism in kinesin-like protein-6 and coronary artery disease in 19 case-control studies.
20927332 2010 Investigation of KIF6 Trp719Arg in a case-control study of myocardial infarction: a Costa Rican population.
20886236 2011 Genetic variants in the KIF6 region and coronary event reduction from statin therapy.
20854963 2010 KIF6 polymorphism as a predictor of risk of coronary events and of clinical event reduction by statin therapy.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20659029 2010 [Motor protein Kinesin-6 and ischemic heart disease].
20403483 2010 Effect of pravastatin therapy on coronary events in carriers of the KIF6 719Arg allele from the cholesterol and recurrent events trial.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215968 2010 KIF6 Trp719Arg polymorphism and the effect of statin therapy in elderly patients: results from the PROSPER study.
20044086 2010 The polymorphism Trp719Arg in the kinesin-like protein 6 is associated with the presence of late outgrowth endothelial progenitor cells in acute myocardial infarction.
19752551 2009 Polymorphisms associated with both noncardioembolic stroke and coronary heart disease: vienna stroke registry.
19060904 2009 An empirical framework for binary interactome mapping.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18846501 2008 Does parental expressed emotion moderate genetic effects in ADHD? An exploration using a genome wide association scan.
18510970 2008 Association of the 719Arg variant of KIF6 with both increased risk of coronary events and with greater response to statin therapy.
18222355 2008 Polymorphism in KIF6 gene and benefit from statins after acute coronary syndromes: results from the PROVE IT-TIMI 22 study.
18222354 2008 A kinesin family member 6 variant is associated with coronary heart disease in the Women's Health Study.
18222353 2008 Association of the Trp719Arg polymorphism in kinesin-like protein 6 with myocardial infarction and coronary heart disease in 2 prospective trials: the CARE and WOSCOPS trials.
18073581 2007 Five common gene variants identify elevated genetic risk for coronary heart disease.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.