Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.44
PubTator Score 16.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma -3.000 4.2e-04
posterior fossa group A ependymoma -2.900 2.5e-13
oligodendroglioma -1.300 2.9e-02
glioblastoma -3.200 1.2e-03
group 4 medulloblastoma -2.500 3.3e-05
atypical teratoid / rhabdoid tumor -3.300 1.9e-06
medulloblastoma, large-cell -2.200 1.1e-02
intraductal papillary-mucinous adenoma (... -1.400 3.4e-02
intraductal papillary-mucinous carcinoma... -1.500 4.7e-02
colon cancer -2.900 8.4e-05
lung cancer 3.900 8.7e-05
fibroadenoma 1.900 1.3e-03
Breast cancer 3.500 2.2e-02
interstitial cystitis -3.200 3.6e-06
pediatric high grade glioma -2.600 9.5e-06
pilocytic astrocytoma -1.900 1.1e-05
lung carcinoma 4.800 9.1e-58
Pick disease -1.200 1.9e-04
ovarian cancer 1.800 2.5e-02
pituitary cancer -2.100 4.1e-07
facioscapulohumeral dystrophy 1.800 7.7e-03

Gene RIF (6)

PMID Text
24812067 Genetic association of KIF4A and KIF5C mutations in intellectual disability and synaptic function.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19011756 Results identified the motor neuron protein KIF5C as a new binding partner for the protein kinase CK2alpha'.
18682247 KIF5C, a member of the kinesin 1 heavy chain family, is a substrate for protein kinase CK2.
17887960 binding of the kinesin-binding domain of RanBP2 to KIF5B and KIF5C determines mitochondria localization and function
16835241 analysis of the GRIF-1 binding domain of the kinesin, KIF5C, which substantiates a role for GRIF-1 as an adaptor protein in the anterograde trafficking of cargoes

AA Sequence

MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQI      1 - 70
VKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYL     71 - 140
DKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFL    141 - 210
INIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYR    211 - 280
DSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEK    281 - 350
EKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEE    351 - 420
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQA    421 - 490
LEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGE    491 - 560
IGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQ    561 - 630
LLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMK    631 - 700
KALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKL    701 - 770
LLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENN    771 - 840
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRA    841 - 910
KNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK                           911 - 957
//

Text Mined References (21)

PMID Year Title
24812067 2014 Involvement of the kinesin family members KIF4A and KIF5C in intellectual disability and synaptic function.
23603762 2013 Mutations in TUBG1, DYNC1H1, KIF5C and KIF2A cause malformations of cortical development and microcephaly.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19135897 2009 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility.
19011756 2009 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit.
18682247 2008 The kinesin I family member KIF5C is a novel substrate for protein kinase CK2.
17887960 2007 Association of the kinesin-binding domain of RanBP2 to KIF5B and KIF5C determines mitochondria localization and function.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16835241 2006 Mapping the GRIF-1 binding domain of the kinesin, KIF5C, substantiates a role for GRIF-1 as an adaptor protein in the anterograde trafficking of cargoes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15644324 2005 GRIF-1 and OIP106, members of a novel gene family of coiled-coil domain proteins: association in vivo and in vitro with kinesin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9782088 1998 Chromosomal localization reveals three kinesin heavy chain genes in mouse.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9361024 1997 Huntingtin-associated protein 1 (HAP1) interacts with the p150Glued subunit of dynactin.
7514426 1994 Cloning and localization of a conventional kinesin motor expressed exclusively in neurons.