Property Summary

NCBI Gene PubMed Count 42
PubMed Score 78.01
PubTator Score 38.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 2.378 1.3e-04
adult high grade glioma 2.400 1.9e-05
Astrocytoma, Pilocytic 1.300 1.9e-05
Atopic dermatitis 1.700 2.3e-05
atypical teratoid / rhabdoid tumor 2.900 3.2e-11
Breast cancer 3.100 7.9e-25
breast carcinoma 1.400 9.8e-42
colon cancer 1.900 2.8e-03
ductal carcinoma in situ 2.500 8.6e-04
Endometriosis 1.211 1.2e-02
ependymoma 1.700 3.2e-02
glioblastoma 3.100 7.1e-12
group 3 medulloblastoma 3.900 4.9e-08
intraductal papillary-mucinous carcinoma... 2.300 3.1e-05
intraductal papillary-mucinous neoplasm ... 2.700 8.9e-05
invasive ductal carcinoma 3.100 2.9e-05
lung adenocarcinoma 1.300 4.3e-11
lung cancer 2.000 9.2e-03
malignant mesothelioma 1.500 5.7e-06
medulloblastoma, large-cell 3.200 5.0e-07
non-small cell lung cancer 3.014 5.2e-33
oligodendroglioma 1.100 6.5e-06
ovarian cancer 2.300 6.2e-07
pancreatic cancer 1.200 9.3e-06
pituitary cancer 2.800 6.8e-06
primitive neuroectodermal tumor 3.300 1.2e-07
psoriasis 1.200 2.4e-35

 MGI Phenotype (1)

Gene RIF (28)

AA Sequence

MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVA      1 - 70
PLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDKKSDFEFTLKVSY     71 - 140
LEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSS    141 - 210
RSHAIFTISLEQRKKSDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDD    211 - 280
KKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVNIDPQTAE    281 - 350
LNHLKQQVQQLQVLLLQAHGGTLPGSITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERI    351 - 420
ILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACMAAAIDT    421 - 490
AVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQLQPIQYQYQDN    491 - 560
IKELELEVINLQKEKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLNEQSKLLKLKESTE    561 - 630
RTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSNVL    631 - 700
RRKTEEAAAANKRLKDALQKQREVADKRKETQSRGMEGTAARVKNWLGNEIEVMVSTEEAKRHLNDLLED    701 - 770
RKILAQDVAQLKEKKESGENPPPKLRRRTFSLTEVRGQVSESEDSITKQIESLETEMEFRSAQIADLQQK    771 - 840
LLDAESEDRPKQRWENIATILEAKCALKYLIGELVSSKIQVSKLESSLKQSKTSCADMQKMLFEERNHFA    841 - 910
EIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLLSTLKCQDEELEKMREVCEQN    911 - 980
QQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEH    981 - 1050
SVNEHEDGDGDDDEGDDEEWKPTKLVKVSRKNIQGCSCKGWCGNKQCGCRKQKSDCGVDCCCDPTKCRNR   1051 - 1120
QQGKDSLGTVERTQDSEGSFKLEDPTEVTPGLSFFNPVCATPNSKILKEMCDVEQVLSKKTPPAPSPFDL   1121 - 1190
PELKHVATEYQENKAPGKKKKRALASNTSFFSGCSPIEEEAH                               1191 - 1232
//

Text Mined References (49)

PMID Year Title