Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.86
PubTator Score 17.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 1.4e-04
atypical teratoid / rhabdoid tumor -1.500 7.4e-09
Barrett's esophagus 1.200 1.5e-02
esophageal adenocarcinoma 1.700 1.8e-02
glioblastoma -1.400 1.2e-04
medulloblastoma, large-cell -1.800 5.9e-05
osteosarcoma 1.551 1.4e-04
ovarian cancer 1.100 1.0e-03
primitive neuroectodermal tumor -1.100 1.8e-04

Protein-protein Interaction (2)

Gene RIF (10)

AA Sequence

MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQF      1 - 70
ELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLV     71 - 140
RASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNE    141 - 210
HSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVIS    211 - 280
ALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDP    281 - 350
KDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEK    351 - 420
LEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQQK    421 - 490
ILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQE    491 - 560
EHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIMNRAFFDEEEDHWKLHPITRLENQQMMKRPV    561 - 630
SAVGYKRPLSQHARMSMMIRPEARYRAENIVLLELDMPSRTTRDYEGPAIAPKVQAALDAALQDEDEIQV    631 - 700
DASSFESTANKKSKARPKSGRKSGSSSSSSGTPASQLYPQSRGLVPK                           701 - 747
//

Text Mined References (35)

PMID Year Title