Property Summary

NCBI Gene PubMed Count 43
PubMed Score 107.38
PubTator Score 47.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.800 3.2e-05
glioblastoma -2.600 6.9e-06
osteosarcoma 1.272 8.6e-05
ependymoma -1.600 2.8e-11
medulloblastoma -2.000 1.2e-05
atypical teratoid / rhabdoid tumor -2.300 3.8e-07
medulloblastoma, large-cell -3.200 6.1e-06
adrenocortical carcinoma 1.700 6.4e-06
Parkinson's disease -1.200 1.2e-02
pediatric high grade glioma -2.000 2.1e-06
lung carcinoma 1.700 3.1e-21
chronic rhinosinusitis -1.160 3.9e-02
cystic fibrosis and chronic rhinosinusit... -1.353 2.5e-02

Gene RIF (24)

PMID Text
26127003 KIF3A and OVOL1 are involved in the development of Atopic dermatitis in the Chinese pediatric population.
25878107 Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression.
25588831 These data suggest that GLI interactions with KIF3A-KIF3B-KAP3 complexes are essential for proper GLI transcriptional activity.
24413182 Findings support the notion that upregulation of KIF3a is causal of aberrant activation of Wnt signaling in advanced prostate cancer through the KIF3a-DVL2-beta-catenin axis.
24338362 POPX2 affects trafficking by determining the phosphorylation status of KIF3A at serine 690.
23386061 in addition to its ciliogenic roles, Kif3a recruits p150(Glued) to the subdistal appendages of mother centrioles, critical for centrosomes to function as microtubule-organizing centres.
23278845 Association of KIF3A, but not OVOL1 and ACTL9, with atopic eczema in Italian patients
21912604 KIF3A is a novel candidate gene for childhood asthma
21841072 Changes of IP7 intracellular levels affect HIV-1 Gag release through modulation of AP3B1 and Kif3A interaction
20922562 Our findings suggest that the KIF3A gene and/or its polymorphisms might have a susceptibility effect on aspirin-intolerant asthma (AIA).
20922562 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485362 Variants carried by the haplotypes of SLC22A4, SLC22A5 and KIF3A region potentially contribute to tuberculosis susceptibility among the Thai population.
20485362 Observational study of gene-disease association. (HuGE Navigator)
20133826 Changes of IP7 intracellular levels affect HIV-1 Gag release through modulation of AP3B1 and Kif3A interaction
20066075 KIF3, cilia, and nodal flow have roles in left-right determination [review]
19934039 Changes of IP7 intracellular levels affect HIV-1 Gag release through modulation of AP3B1 and Kif3A interaction
19282970 This study thus reports on transportation of KSHV viral complexes on microtubules by KIF3A
19043453 Protein phosphatase Dusp26 associates with KIF3 motor and promotes N-cadherin-mediated cell-cell adhesion.
18957512 Rip11/FIP5-kinesin-II complex plays a key role in the routing of internalized receptors through the perinuclear recycling endosomes.
18854154 Knockdown of kinesin family member 3A (KIF3A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17418584 We detected ALS-specific down-regulation of KIF1Bbeta and novel KIF3Abeta, two isoforms we show to be enriched in the brain, and also of SOD1, a key enzyme linked to familial ALS
16298999 Interaction of KIF3A/3B with KAP3 may be important for the proper progression of mitosis.
16262723 Required for the normal steady-state localization of late endosomes/lysosomes but not early endosomes or recycling endosomes.
15345558 both motor domains of KIF3A/B coordinate for processive motility and move at different speeds

AA Sequence

MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPE      1 - 70
SKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGD     71 - 140
TRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGA    141 - 210
TNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTL    211 - 280
GNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKAR    281 - 350
INEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMI    351 - 420
EMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKA    421 - 490
EEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEM    491 - 560
ADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMR    561 - 630
KQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ     631 - 699
//

Text Mined References (46)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26127003 2015 Correlation of KIF3A and OVOL1, but not ACTL9, with atopic dermatitis in Chinese pediatric patients.
26021297 2015 The small GTPase Rab29 is a common regulator of immune synapse assembly and ciliogenesis.
25878107 2015 Herpes Simplex Virus 1 US3 Phosphorylates Cellular KIF3A To Downregulate CD1d Expression.
25588831 2015 The heterotrimeric kinesin-2 complex interacts with and regulates GLI protein function.
24591568 2014 FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis.
24413182 2014 KIF3a promotes proliferation and invasion via Wnt signaling in advanced prostate cancer.
24338362 2014 POPX2 phosphatase regulates the KIF3 kinesin motor complex.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
23386061 2013 Kif3a interacts with Dynactin subunit p150 Glued to organize centriole subdistal appendages.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23278845 2013 Association of KIF3A, but not OVOL1 and ACTL9, with atopic eczema in Italian patients.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22261744 2012 Neuronal ceroid lipofuscinosis protein CLN3 interacts with motor proteins and modifies location of late endosomal compartments.
22197932 2011 Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis.
21912604 2011 Identification of KIF3A as a novel candidate gene for childhood asthma using RNA expression and population allelic frequencies differences.
21269460 2011 Initial characterization of the human central proteome.
20922562 2011 KIF3A, a cilia structural gene on chromosome 5q31, and its polymorphisms show an association with aspirin hypersensitivity in asthma.
20643351 2010 Pitchfork regulates primary cilia disassembly and left-right asymmetry.
20485362 2010 Association analysis of susceptibility candidate region on chromosome 5q31 for tuberculosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20066075 2009 Left-right determination: involvement of molecular motor KIF3, cilia, and nodal flow.
19282970 2009 Kaposi's sarcoma-associated herpesvirus ORF45 interacts with kinesin-2 transporting viral capsid-tegument complexes along microtubules.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19043453 2009 Protein phosphatase Dusp26 associates with KIF3 motor and promotes N-cadherin-mediated cell-cell adhesion.
18957512 2008 The Rip11/Rab11-FIP5 and kinesin II complex regulates endocytic protein recycling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17418584 2007 Differential expression of molecular motors in the motor cortex of sporadic ALS.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16298999 2006 Role of the kinesin-2 family protein, KIF3, during mitosis.
16262723 2005 Kinesin-2 is a motor for late endosomes and lysosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235292 2002 Visualization of translated tau protein in the axons of neuronal P19 cells and characterization of tau RNP granules.
11912492 2002 Identification of a link between the tumour suppressor APC and the kinesin superfamily.
10631107 2000 Interaction between GADD34 and kinesin superfamily, KIF3A.
10548469 1999 Photoreceptor localization of the KIF3A and KIF3B subunits of the heterotrimeric microtubule motor kinesin II in vertebrate retina.
9506951 1998 Complex formation of SMAP/KAP3, a KIF3A/B ATPase motor-associated protein, with a human chromosome-associated polypeptide.
9450952 1998 Characterization of the KIF3C neural kinesin-like motor from mouse.
9427749 1998 The MAP kinase kinase kinase MLK2 co-localizes with activated JNK along microtubules and associates with kinesin superfamily motor KIF3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7559760 1995 KIF3A/B: a heterodimeric kinesin superfamily protein that works as a microtubule plus end-directed motor for membrane organelle transport.
1447303 1992 Kinesin family in murine central nervous system.
1054846 1975 A theory of evolution above the species level.