Property Summary

NCBI Gene PubMed Count 30
PubMed Score 35.88
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.500 6.3e-07
cutaneous lupus erythematosus 1.600 4.9e-04
osteosarcoma -1.005 9.3e-03
adrenocortical carcinoma 1.530 2.4e-04
non-small cell lung cancer 1.734 3.7e-25
lung cancer 1.500 9.2e-03
active Crohn's disease 1.045 2.8e-02
primary Sjogren syndrome 1.200 1.5e-03
ovarian cancer 2.000 1.0e-04

Gene RIF (22)

PMID Text
26707290 KIF2A may be important in glioma progression.
26323690 TTBK2 phosphorylates KIF2A and antagonizes KIF2A-induced depolymerization at microtubules plus ends for cell migration.
26070867 This study demonstrated colorectal cancer (CRC) tissue-preferred expression pattern of the KIF2A and suggested that high KIF2A expression might serve as an independent maker for poor prognosis in CRC patients.
25002494 up-regulation of KIF2C and KIF2A by ERK1/2 caused aberrant lysosomal positioning and mTORC1 activity in a mutant K-Ras-dependent cancer and cancer model.
24950762 KIF2A may play an important role in breast cancer progression and is potentially a novel predictive and prognostic marker for breast cancer.
24248467 Silencing Kif2a induces apoptosis and decreases the mRNA and protein level of PI3K, Akt and Bcell lymphoma 2 (Bcl2) in Tca8113 cells.
24240690 Ras regulates KIF2A to control cell migration pathways in transformed human bronchial epithelial cells.
23960144 The distribution of Kif2A was limited to the distal ends of the central spindle through Aurora B-dependent phosphorylation and exclusion from the spindle midzone.
23166591 Expression of HIV-1 Tat downregulates the abundance of kinesin heavy chain member 2A (KIF2A) in the nucleoli of Jurkat T-cells
22184201 The kinesin-2 deficiency weakened intercellular adhesion, despite the maintenance of adherens junctions and other desmosome components at the plasma membrane.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19996280 Data show that 4-oxo-4-HPR inhibited tubulin polymerization and modulated gene expression of spindle aberration associated genes Kif 1C, Kif 2A, Eg5, Tara, tankyrase-1, centractin, and TOGp.
19940135 Targeting of integrin beta1 and kinesin 2alpha by microRNA 183.
19351716 Data show that Kif2a is regulated positively by Plk1 and negatively by Aurora A, and suggest that this antagonistic regulation confers differential stability to microtubules in the spindle versus at the pole versus in the cytosol.
18411309 DDA3 interacts with the MT depolymerase Kif2a in an microtubule-dependent manner and recruits Kif2a to the mitotic spindle and spindle poles.
17538014 These data demonstrate that Kif2b function is required for spindle assembly and chromosome movement and that the microtubule depolymerase activities of Kif2a, Kif2b, and MCAK fulfill distinct functions during mitosis in human cells.
17394562 kinesin-1, but not kinesin-2, contributes to the specific cytoplasmic distribution of three of the four steps of VV morphogenesis tested.
16959419 Observational study of gene-disease association. (HuGE Navigator)
16959419 KIF2 gene, located at 5q12.1, is a potential schizophrenia susceptibility gene
16243029 Spindles in human mitotic cells depleted of the kinesin-13 proteins Kif2a and MCAK lack detectable flux and that such cells frequently fail to segregate all chromosomes appropriately at anaphase.
15302853 Kif2a has a role in bipolar spindle assembly along with MCAK

AA Sequence

MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDE      1 - 70
EIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDIS     71 - 140
PVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDY    141 - 210
RPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAF    211 - 280
DDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLML    281 - 350
KKPNYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSC    351 - 420
RTSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKE    421 - 490
CIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLRYANRVKELTVDPTAA    491 - 560
GDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRA    561 - 630
VFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINP    631 - 700
KRPRAL                                                                    701 - 706
//

Text Mined References (37)

PMID Year Title
27697924 2016 ASB7 regulates spindle dynamics and genome integrity by targeting DDA3 for proteasomal degradation.
26707290 2016 Role of KIF2A in the progression and metastasis of human glioma.
26323690 2015 TTBK2 with EB1/3 regulates microtubule dynamics in migrating cells through KIF2A phosphorylation.
26070867 2015 KIF2A overexpression and its association with clinicopathologic characteristics and unfavorable prognosis in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25002494 2014 Ras transformation uncouples the kinesin-coordinated cellular nutrient response.
24950762 2014 KIF2A silencing inhibits the proliferation and migration of breast cancer cells and correlates with unfavorable prognosis in breast cancer.
24248467 2014 Silencing Kif2a induces apoptosis in squamous cell carcinoma of the oral tongue through inhibition of the PI3K/Akt signaling pathway.
24240690 2014 Ras regulates kinesin 13 family members to control cell migration pathways in transformed human bronchial epithelial cells.
23960144 2013 Aurora B and Kif2A control microtubule length for assembly of a functional central spindle during anaphase.
23603762 2013 Mutations in TUBG1, DYNC1H1, KIF5C and KIF2A cause malformations of cortical development and microcephaly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22184201 2011 Desmosomal cadherins utilize distinct kinesins for assembly into desmosomes.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19996280 2009 Antimitotic effect of the retinoid 4-oxo-fenretinide through inhibition of tubulin polymerization: a novel mechanism of retinoid growth-inhibitory activity.
19946888 2010 Defining the membrane proteome of NK cells.
19940135 2010 Targeting of integrin beta1 and kinesin 2alpha by microRNA 183.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19351716 2009 Plk1 and Aurora A regulate the depolymerase activity and the cellular localization of Kif2a.
18411309 2008 DDA3 recruits microtubule depolymerase Kif2a to spindle poles and controls spindle dynamics and mitotic chromosome movement.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17538014 2007 The kinesin-13 proteins Kif2a, Kif2b, and Kif2c/MCAK have distinct roles during mitosis in human cells.
17394562 2007 Kinesin-1 plays multiple roles during the vaccinia virus life cycle.
16959419 2006 A family-based association study of kinesin heavy chain member 2 gene (KIF2) and schizophrenia.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16243029 2005 Efficient mitosis in human cells lacking poleward microtubule flux.
15843429 2005 Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302853 2004 The KinI kinesin Kif2a is required for bipolar spindle assembly through a functional relationship with MCAK.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9177777 1997 Identification of a novel human kinesin-related gene (HK2) by the cDNA differential display technique.