Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available

 Compartment GO Term (0)

AA Sequence

ARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA                                 141 - 181

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10382971 1999 Complete DNA sequence and characterization of a 330-kb VNTR-rich region on chromosome 6q27 that is commonly deleted in ovarian cancer.