Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.25
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 0.0314577336075768
fibroadenoma 557 0.0362049176931614

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.400 0.031
fibroadenoma -2.400 0.036

Synonym

Accession Q9UIL4 O94775 Q5SZU9
Symbols KNSL3

Gene

  Ortholog (5)

Species Source
Macaque OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MTWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLTSLLDGYNVCVMAYGQTGSG      1 - 70
KSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFRLILENTSRSPKVEVSIVEVYNNDIFDLLAKDSIA     71 - 140
AVSGVKREVVTAKDGRTEVALLASEAVGSASKLMELVHGGLQLRAKHPTLVHADSSRSHLIITVTLTTAS    141 - 210
CSDSTADQACSATLPREQTEAGRAGRSRRASQGALAPQLVPGNPAGHAEQVQARLQLVDSAGSECVGVSG    211 - 280
VTGLALREMACISRSLAALAGVLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQT    281 - 350
LQGLGFGIRARQVQRGPARKKPPSSQTEGKRRPD                                        351 - 384
//

Text Mined References (7)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416179 2001 All kinesin superfamily protein, KIF, genes in mouse and human.
9925916 1998 Identification, genomic organization, and alternative splicing of KNSL3, a novel human gene encoding a kinesin-like protein.
9925910 1998 Assignment1 of CSRP1 encoding the LIM domain protein CRP1, to human chromosome 1q32 by fluorescence in situ hybridization.