Property Summary

NCBI Gene PubMed Count 29
PubMed Score 34.76
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma 1.200 6.4e-06
psoriasis 2.500 1.8e-04
glioblastoma 3.500 1.4e-05
posterior fossa group A ependymoma 2.400 4.3e-07
group 3 medulloblastoma 4.500 1.2e-08
atypical teratoid / rhabdoid tumor 3.900 2.2e-13
medulloblastoma, large-cell 4.500 1.2e-07
primitive neuroectodermal tumor 4.100 3.7e-07
Atopic dermatitis 2.400 6.6e-06
adrenocortical carcinoma 2.386 8.5e-05
non-small cell lung cancer 2.858 1.1e-32
intraductal papillary-mucinous carcinoma... 2.400 3.3e-04
intraductal papillary-mucinous neoplasm ... 3.100 1.7e-03
lung cancer 3.000 1.2e-05
colon cancer 2.100 4.2e-04
pancreatic cancer 1.300 1.8e-04
Breast cancer 3.200 9.1e-21
lung adenocarcinoma 1.500 1.2e-10
pediatric high grade glioma 3.100 3.5e-07
pilocytic astrocytoma 1.200 4.9e-04
acute myeloid leukemia -1.100 3.2e-02
Endometriosis 2.448 8.7e-03
breast carcinoma 1.600 5.4e-37
ductal carcinoma in situ 2.500 1.1e-03
invasive ductal carcinoma 3.100 5.2e-05
ovarian cancer 1.900 7.5e-06

Protein-protein Interaction (1)

Gene RIF (13)

PMID Text
25961928 we identify KIF20A as a direct transcriptional target of FOXM1, involved in paclitaxel action and resistance
25953216 Kif20a expression was upregulated in pancreatic ductal adenocarcinoma and pancreatic neuroendocrine cancer compared with normal pancreas. Kif20a silencing resulted in inhibition of proliferation, motility, and invasion of pancreatic cancer cell lines.
25499221 Our results provide insight into the link between regulation of KIF20A-mediated trafficking of IGF2BP3-containing stress granules and modulation of the motility and invasiveness in pancreatic cancers.
24656812 Authors propose that phosphoregulation of MKlp2 by Cdk1/cyclin B1 ensures that activation of MKlp2 kinesin and relocation of the CPC occur at the appropriate time and space for proper mitotic progression and genomic stability.
23750214 targeting Aurora B to the cell cortex (or the equatorial cortex) by MKlp2 is essential for the maintenance of the ingressing furrow for successful cytokinesis
22887948 Used proteomics to identify the genistein-induced protein alterations in gastric cancer cells and found the silencing of KIF20A inhibited cell viability and induced G2/M arrest,& also increased cancer cell sensitivity to genistein inhibition.
22854760 Primary melanomas that were positive for KIF20A showed a significantly greater thickness than those that were negative, and patients with KIF20A+ melanoma tended to develop recurrence earlier.
19303298 Data demonstrate that Mklp2 and the chromosomal passenger complex mutually depend on each other for microtubule midzone localization, and that the association between the CPC and Mklp2 is negatively regulated by Cdk1.
15665285 Collaboration of RAB6KIFL and disc large homologue 5 is likely to be involved in pancreatic cancer.
15263015 Relocation of the Aurora B/INCENP/survivin passenger protein complex requires KIF20A (MKlp2).
12939256 KIF20A (MKlp2) is required for targeting of the polo like kinase 1 during anaphase and telophase cells.
12469216 This gene is not involved in Charcot-Marie-Tooth disease.
11060022 KIF20A (Rab6KIFL/MKlp2) is required for cytokinesis

AA Sequence

MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLR      1 - 70
VRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLT     71 - 140
VKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVI    141 - 210
WLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETS    211 - 280
HRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQ    281 - 350
DAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS    351 - 420
GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCAST    421 - 490
YDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGK    491 - 560
EELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILK    561 - 630
ESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCK    631 - 700
AELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGK    701 - 770
LRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN    771 - 840
QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY                        841 - 890
//

Text Mined References (38)

PMID Year Title
25961928 2016 Paclitaxel targets FOXM1 to regulate KIF20A in mitotic catastrophe and breast cancer paclitaxel resistance.
25953216 2015 Kif20a inhibition reduces migration and invasion of pancreatic cancer cells.
25499221 2014 KIF20A-mediated RNA granule transport system promotes the invasiveness of pancreatic cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24656812 2014 Cdk1 coordinates timely activation of MKlp2 kinesin with relocation of the chromosome passenger complex for cytokinesis.
23750214 2013 Targeting Aurora B to the equatorial cortex by MKlp2 is required for cytokinesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22887948 2012 Genistein-induced mitotic arrest of gastric cancer cells by downregulating KIF20A, a proteomics study.
22854760 2012 Kinesin family member 20A is a novel melanoma-associated antigen.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19303298 2009 Cdk1 negatively regulates midzone localization of the mitotic kinesin Mklp2 and the chromosomal passenger complex.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16431929 2006 KIF14 and citron kinase act together to promote efficient cytokinesis.
16381901 2006 The LIFEdb database in 2006.
15843429 2005 Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference.
15665285 2005 Down-regulation of RAB6KIFL/KIF20A, a kinesin involved with membrane trafficking of discs large homologue 5, can attenuate growth of pancreatic cancer cell.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15263015 2004 Relocation of Aurora B from centromeres to the central spindle at the metaphase to anaphase transition requires MKlp2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939256 2003 Phosphorylation of mitotic kinesin-like protein 2 by polo-like kinase 1 is required for cytokinesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469216 2003 The kinesin superfamily protein Rab6KIFL is not involved in the pathophysiology of Charcot-Marie-Tooth disease type 4C.
11416179 2001 All kinesin superfamily protein, KIF, genes in mouse and human.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11071909 2000 Alternative splicing of the human Rab6A gene generates two close but functionally different isoforms.
11060022 2000 The Rab6-binding kinesin, Rab6-KIFL, is required for cytokinesis.
10893188 2000 The small GTPase Rab6B, a novel Rab6 subfamily member, is cell-type specifically expressed and localised to the Golgi apparatus.
10806357 2000 cDNA cloning, expression pattern, genomic structure and chromosomal location of RAB6KIFL, a human kinesin-like gene.
10233894 1999 Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.
9438855 1998 Interaction of a Golgi-associated kinesin-like protein with Rab6.