Property Summary

NCBI Gene PubMed Count 67
PubMed Score 108.91
PubTator Score 102.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.500 2.4e-02
glioblastoma -1.800 4.8e-02
oligodendroglioma 1.100 4.0e-10
osteosarcoma 1.044 1.2e-04
atypical teratoid / rhabdoid tumor 1.700 1.5e-03
medulloblastoma, large-cell -1.200 1.4e-04
Amyotrophic Lateral Sclerosis 1.027 1.5e-06
type 2 diabetes -1.032 1.7e-02
primary pancreatic ductal adenocarcinoma 1.025 2.1e-02
lung cancer 1.900 6.7e-05
pediatric high grade glioma 1.500 1.8e-06
group 3 medulloblastoma 1.100 2.6e-02
pilocytic astrocytoma -1.400 1.6e-08
posterior fossa group A ependymoma -1.100 1.3e-10
subependymal giant cell astrocytoma -2.344 1.0e-02
gastric carcinoma 1.100 6.8e-03
ovarian cancer 1.300 1.0e-03
pituitary cancer 1.400 1.6e-06

Protein-protein Interaction (7)

Gene RIF (39)

PMID Text
26812016 that KIF1Bbeta affects mitochondrial dynamics through calcineurin-dependent dephosphorylation of Dynamin-related protein 1 (DRP1), causing mitochondrial fission and apoptosis
26576027 Increased KIF1B was associated with worse WHO pathological classification, Karnofsky performance status, and prognosis. Silencing KIF1B inhibited expression of membranal MT1-MMP.
26217094 Downregulation of KIF1B in hepatocellular carcinoma tissues is associated with poor prognosis.
25854172 the rs17401966 polymorphism likely regulates KIF1B mRNA expression and thus may be associated with epithelial ovarian cancer risk in Eastern Chinese women.
25818806 The ability of exogenously expressed FEZ1 binding to kinesin-1 to promote early HIV-1 infection, leading to the movement of HIV-1 CA core to the nucleus
25518808 The tumor suppressor DLC2 and Kif1B are central components of a signaling network that guides spindle positioning, cell-cell adhesion and mitotic fidelity.
25355294 Results from targeted sequencing in patients with acute lymphoblastic leukemia identified KMT2D and KIF1B as novel putative driver genes and a putative regulatory non-coding variant that coincided with overexpression of the growth factor MDK.
25153661 The variant G allele of rs17401966 may be a favorable biomarker for the prognosis of intermediate or advanced hepatitis B virus-related hepatocellular carcinoma patients in this Chinese population
24952890 The meta-analysis showed a significant association between kinesin family member 1B (KIF1B) single nucleotide polymorphism (rs17401966) and hepatocellular carcinoma (HCC).
24469107 Results show that KIF1Bbeta has neuroblastoma tumor-suppressor properties and promotes and requires nuclear-localized DHX9 for its apoptotic function by activating XAF1 expression.
23831022 analysis of the recognition sequence for DJ-1 protease and its interactions with KIF1B and ABL1
23803045 the KIF1B gene SNP (rs174019660) showed no significant association with HBV-related hepatocellular carcinoma in Thai patients infected with HBV, indicating that there must be other mechanisms or pathways involved in hepatocellular carcinoma.
23634229 KIF1B may play a critical role in the development of hepatocellular carcinoma
23528589 the TT genotype of rs1535045 was associated with a slower progression of MS and early MS onset.
23354307 Leptin, MT1-MMP and KIF1B are overexpressed in GC tissues.
23028799 Polymorphisms at KIF1B gene locus investigated in this study showed no significant association with Hepatitis B virus infection.
22945799 activity-dependent synaptic recruitment of KIF1Bbeta, its interaction with Ca(2 ) sensor Calmodulin and its role as a dendritic motor of ribonucleoprotein complexes provide a novel basis for understanding the coordination of motor protein mobilization and synaptic signaling pathways
22363396 This study showed the new locus identified for hepatocellular carcinoma, KIF1B, was not associated with progression to chronic hepatitis B.
21680216 Polymorphic locus rs10492972 of the KIF1B gene associates with multiple sclerosis in Russia.
21606458 Data show that no evidence could be found for a determining influence of carriership of the risk allele or genotype of the KIF1B gene on any of the multiple sclerosis neurodegenerative phenotypic markers studied.
21594895 analysis of the KIF1B rs10492972*C allelic association in multiple sclerosis
21424745 No association is found between rs10492972 KIF1B polymorphism and the progression of multiple sclerosis in Greek subjects.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20676096 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20502484 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20190806 Bmi1 is a MYCN target gene that regulates tumorigenesis through repression of KIF1Bbeta and TSLC1 in neuroblastoma.
20067515 KIF1B rs10492972 allelic variant does not act as a risk factor as well as a disease modifier in a Italian cohort of patients with progressive relapsing multiple sclerosis.
20067515 Observational study of gene-disease association. (HuGE Navigator)
19776380 Observational study of gene-disease association. (HuGE Navigator)
18997785 Study reports a genome wide association study identifying a new locus replicated in 2,679 cases and 3,125 controls; an rs10492972[C] variant located in the KIF1B gene was associated with MS with an odds ratio of 1.35 (P = 2.5 x 10(-10)).
18997785 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18726616 a germline mutation in the KIF1B beta gene on 1p36 may have a role in neural and nonneural tumors
18614535 KIF1Bbeta may act as a haploinsufficient tumor suppressor, and its allelic loss may be involved in the pathogenesis of neuroblastoma and other cancers.
18334619 Study identified inherited loss-of-function KIF1Bbeta missense mutations in neuroblastomas and pheochromocytomas and an acquired loss-of-function mutation in a medulloblastoma.
17418584 We detected ALS-specific down-regulation of KIF1Bbeta and novel KIF3Abeta, two isoforms we show to be enriched in the brain, and also of SOD1, a key enzyme linked to familial ALS.
16225668 KBP is a new binding partner for KIF1Balpha that is a regulator of its transport function and thus represents a new type of kinesin interacting protein.
12888911 KIF1Ba in addition to KIF1Bbeta may not be a candidate tumor suppressor gene for neuroblastoma
11835375 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTSPEDPCFASQ      1 - 70
NRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSY     71 - 140
SVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNM    141 - 210
NETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGK    211 - 280
VISALAEVDNCTSKSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADR    281 - 350
AKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL    351 - 420
LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNET    421 - 490
WEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQ    491 - 560
ADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPCERSETYVNGKRVSQPVQLRSGNRIIMGKNH    561 - 630
VFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLL    631 - 700
EQQRLDYESKLQALQKQVETRSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNA    701 - 770
VYLKEANAISVELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW    771 - 840
SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCVNERLADRTPS    841 - 910
PTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGHDPFYDRSPWFILVGRAFVYL    911 - 980
SNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQSDFSSVA    981 - 1050
MTRSGLSLEELRIVEGQGQSSEVITPPEEISRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFR   1051 - 1120
VTVLQASGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIV   1121 - 1190
FEVFGHYQQHPLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISE   1191 - 1260
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRNKPEVDEAAV   1261 - 1330
DAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVI   1331 - 1400
TKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKMSDTGSPGMQRRRRKILDTSVA   1401 - 1470
YVRGEENLAGWRPRGDSLILEHQWELEKLELLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLS   1471 - 1540
TSTSISSQISTTTFESAITPSESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSDCKLS   1541 - 1610
DISPIGRDPSESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLAR   1611 - 1680
AGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVERGIINLSTA   1681 - 1750
QVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTIRSKLSRRCPSQSKY       1751 - 1816
//

Text Mined References (74)

PMID Year Title
26812016 2016 The 1p36 Tumor Suppressor KIF 1B? Is Required for Calcineurin Activation, Controlling Mitochondrial Fission and Apoptosis.
26576027 2016 KIF1B promotes glioma migration and invasion via cell surface localization of MT1-MMP.
26217094 2015 Downregulation of KIF1B mRNA in hepatocellular carcinoma tissues correlates with poor prognosis.
25854172 2015 Polymorphisms in the kinesin-like factor 1 B gene and risk of epithelial ovarian cancer in Eastern Chinese women.
25518808 2014 The tumour suppressor DLC2 ensures mitotic fidelity by coordinating spindle positioning and cell-cell adhesion.
25416956 2014 A proteome-scale map of the human interactome network.
25355294 2015 The mutational landscape in pediatric acute lymphoblastic leukemia deciphered by whole genome sequencing.
25153661 2014 A genetic variant at KIF1B predicts clinical outcome of HBV-related hepatocellular carcinoma in Chinese.
24952890 2014 Association between KIF1B rs17401966 polymorphism and hepatocellular carcinoma risk: a meta-analysis involving 17,210 subjects.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24469107 2014 RNA helicase A is a downstream mediator of KIF1B? tumor-suppressor function in neuroblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23831022 2013 Identification of the recognition sequence and target proteins for DJ-1 protease.
23803045 2013 The KIF1B (rs17401966) single nucleotide polymorphism is not associated with the development of HBV-related hepatocellular carcinoma in Thai patients.
23634229 2013 Genetic polymorphism of the kinesin-like protein KIF1B gene and the risk of hepatocellular carcinoma.
23528589 2013 [The effect of genetic factors on the phenotypic expression of multiple sclerosis].
23354307 2013 Leptin-mediated regulation of MT1-MMP localization is KIF1B dependent and enhances gastric cancer cell invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028799 2012 Role of single nucleotide polymorphisms of KIF1B gene in HBV-associated viral hepatitis.
22945799 2013 KIF1B? transports dendritically localized mRNPs in neurons and is recruited to synapses in an activity-dependent manner.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22363396 2012 HBV-related hepatocellular carcinoma susceptibility gene KIF1B is not associated with development of chronic hepatitis B.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21680216 2011 Polymorphic locus rs10492972 of the KIF1B gene association with multiple sclerosis in Russia: case control study.
21606458 2011 No influence of KIF1B on neurodegenerative markers in multiple sclerosis.
21594895 2011 When is the absence of evidence, evidence of absence? Use of equivalence-based analyses in genetic epidemiology and a conclusion for the KIF1B rs10492972*C allelic association in multiple sclerosis.
21424745 2011 The rs10492972 KIF1B polymorphism and disease progression in Greek patients with multiple sclerosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20852589 2010 CLASP1, astrin and Kif2b form a molecular switch that regulates kinetochore-microtubule dynamics to promote mitotic progression and fidelity.
20676096 2010 Genome-wide association study identifies 1p36.22 as a new susceptibility locus for hepatocellular carcinoma in chronic hepatitis B virus carriers.
20502484 2010 Lack of support for association between the KIF1B rs10492972[C] variant and multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190806 2010 Bmi1 is a MYCN target gene that regulates tumorigenesis through repression of KIF1Bbeta and TSLC1 in neuroblastoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20067515 2010 Lack of replication of KIF1B gene in an Italian primary progressive multiple sclerosis cohort.
19776380 2009 Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18997785 2008 Genetic variation in the KIF1B locus influences susceptibility to multiple sclerosis.
18726616 2008 A germline mutation of the KIF1B beta gene on 1p36 in a family with neural and nonneural tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614535 2008 KIF1Bbeta functions as a haploinsufficient tumor suppressor gene mapped to chromosome 1p36.2 by inducing apoptotic cell death.
18334619 2008 The kinesin KIF1Bbeta acts downstream from EglN3 to induce apoptosis and is a potential 1p36 tumor suppressor.
17418584 2007 Differential expression of molecular motors in the motor cortex of sporadic ALS.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16637659 2006 Uncovering quantitative protein interaction networks for mouse PDZ domains using protein microarrays.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16225668 2005 The novel protein KBP regulates mitochondria localization by interaction with a kinesin-like protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697242 2004 Chromosome 13q12 encoded Rho GTPase activating protein suppresses growth of breast carcinoma cells, and yeast two-hybrid screen shows its interaction with several proteins.
12888911 2003 Genomic structure and mutational analysis of the human KIF1Balpha gene located at 1p36.2 in neuroblastoma.
12629046 2003 Facilitation of dendritic mRNA transport by CPEB.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12204119 2002 KIF1Bbeta2, capable of interacting with CHP, is localized to synaptic vesicles.
12097473 2002 Association of the kinesin superfamily motor protein KIF1Balpha with postsynaptic density-95 (PSD-95), synapse-associated protein-97, and synaptic scaffolding molecule PSD-95/discs large/zona occludens-1 proteins.
11835375 2002 Charcot-Marie-Tooth disease and related neuropathies: mutation distribution and genotype-phenotype correlation.
11526494 2001 Genomic structure and mutational analysis of the human KIF1B gene which is homozygously deleted in neuroblastoma at chromosome 1p36.2.
11389829 2001 Charcot-Marie-Tooth disease type 2A caused by mutation in a microtubule motor KIF1Bbeta.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10762626 2000 Identification of the full-length KIAA0591 gene encoding a novel kinesin-related protein which is mapped to the neuroblastoma suppressor gene locus at 1p36.2.
10341097 1999 The major brain isoform of kif1b lacks the putative mitochondria-binding domain.
10198040 1999 Protein interactions with the glucose transporter binding protein GLUT1CBP that provide a link between GLUT1 and the cytoskeleton.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9409358 1997 Linkage mapping of the gene for Charcot-Marie-Tooth disease type 2 to chromosome 1p (CMT2A) and the clinical features of CMT2A.
8854876 1996 The novel gene D4Mil1e maps to mouse chromosome 4 and human chromosome 1p36.
7528108 1994 KIF1B, a novel microtubule plus end-directed monomeric motor protein for transport of mitochondria.