Property Summary

NCBI Gene PubMed Count 34
PubMed Score 29.75
PubTator Score 32.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 1.400 9.9e-07
glioblastoma 3.800 4.5e-10
posterior fossa group A ependymoma 2.300 2.8e-06
group 3 medulloblastoma 4.600 2.1e-10
atypical teratoid / rhabdoid tumor 3.200 2.1e-08
medulloblastoma, large-cell 4.000 2.1e-08
primitive neuroectodermal tumor 4.000 1.3e-05
Atopic dermatitis 2.300 2.0e-06
adrenocortical carcinoma 2.069 1.9e-03
non-small cell lung cancer 2.598 3.1e-32
intraductal papillary-mucinous carcinoma... 2.200 4.0e-05
intraductal papillary-mucinous neoplasm ... 3.300 9.9e-05
colon cancer 2.200 1.3e-02
lung cancer 3.400 1.9e-06
pancreatic cancer 1.500 4.7e-06
interstitial cystitis 1.100 1.0e-02
lung adenocarcinoma 1.400 5.2e-09
pediatric high grade glioma 3.400 2.2e-08
pilocytic astrocytoma 1.100 3.5e-05
nasopharyngeal carcinoma 1.900 1.5e-04
psoriasis 1.900 8.6e-77
Endometriosis 1.699 6.7e-03
Breast cancer 3.100 2.3e-15
ductal carcinoma in situ 1.800 2.9e-02
invasive ductal carcinoma 2.100 1.2e-04
ulcerative colitis 1.300 5.5e-05
ovarian cancer 2.400 6.4e-06

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (27)

PMID Text
25528264 High-grade serous ovarian cancer cells may depend on KIF14 for in vitro proliferation.
25348260 Kinesin-14 blocks microtubule nucleation in yeast and reveal that this inhibition is countered by the kinesin-5 protein, Cut7.[Cut7, Pkl1]
25106407 High KIF14 expression is associated with hepatocellular carcinoma.
24854087 KIF14 knockdown downregulates the expression of Skp2 and Cks1, leading to accumulation of p27Kip1.
24784001 critical role for KIF14 in the tumorigenic potential of triple-negative breast cancer
24626475 analysis of epigenetic regulation of KIF14 overexpression in ovarian cancer
24128419 Mutations in KIF14 identified as a novel cause of an autosomal recessive lethal fetal ciliopathy phenotype.
23626713 KIF14 inhibits tumor growth and cancer metastasis in lung adenocarcinoma.
23479679 Data indicate that KIF14 and TLN1 loss-of-function significantly enhanced chemosensitivity in four triple-negative breast cancer (TNBC) cell lines.
23414349 Suppression of KIF14 not only decreases cancer cell migration but also induces apoptosis of cells.
23209302 It was shown that the kinesin KIF14 associates with the PDZ domain of Radil and negatively regulates Rap1-mediated inside-out integrin activation by tethering Radil on microtubules.
22999822 KIF14 expression in gliomas is tumor-specific and increased in more aggressive tumors. KIF14 might function as a candidate prognostic marker for human gliomas.
21618518 Findings indicate that KIF14 mRNA is an independent prognostic marker in serous ovarian cancer.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19609547 Four genes previously not examined in that respect in laryngeal carcinoma, occurred to be good markers of the neoplasm. They are: metal-proteinase ADAM12, cyclin-dependent kinase 2-CDK2, kinesin 14-KIF14, suppressor 1 of checkpoint-CHES1.
19509238 Results show that the established nerve invasion model and the consensus signature of perineural invasion could be instrumental in the identification of novel therapeutic targets of pancreatic cancer as exemplified by KIF14 and ARHGDIbeta.
19190782 report confirms significant mRNA overexpression of KIF14 and E2F3 together in a large cohort of retinoblastoma tumors
19123481 KIF14 overexpression is associated with papillary renal cell tumors with chromosome 1q duplication.
17962437 Overexpression of KIF14 was confirmed in primary human retinoblastoma and showed that patients with an older age at diagnosis express significantly higher levels of KIF14.
17545527 KIF14 is expressed most highly in squamous cell carcinoma, then in large-cell undifferentiated carcinoma, then adenocarcinoma
17545527 KIF14 mRNA expression is prognostic for disease-free survival in non-small-cell lung cancer. Knockdown inhibits colony formation ability.
17099872 The KIF14 gene is amplified in retinoblastoma; likely an early genomic change in this cancer.
16648480 RNA interference-mediated silencing of KIF14 disrupts cell cycle progression and induces cytokinesis failure.
16570270 KIF14 is overexpressed in primary breast cancer; predicts disease-free and overall survival
16431929 During cytokinesis, the localization of KIF14 and citron kinase to the central spindle and midbody is codependent, and they form a complex depending on the activation state of citron kinase.
15897902 Primary non-small-cell lung carcinoma overexpressing KIF14 showed a trend toward decreased survival.
15897902 Overexpressed in primary retinoblastoma and lung cancer, and in medulloblastoma and breast cancer cell lines. Low expression in normal adult tissue; highly expressed in fetal liver and thymus.

AA Sequence

MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKVRDINRTYVIS      1 - 70
ASRKTADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLTLQRRAKTDSAEKWKTAEIDS     71 - 140
VKMTLNVGGETENNGVSKESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENV    141 - 210
ALKYSSNRPPIASLSQTEVVRSGHLTTKPTQSKLDIKVLGTGNLYHRSIGKEIAKTSNKFGSLEKRTPTK    211 - 280
CTTEHKLTTKCSLPQLKSPAPSILKNRMSNLQVKQRPKSSFLANKQERSAENTILPEEETVVQNTSAGKD    281 - 350
PLKVENSQVTVAVRVRPFTKREKIEKASQVVFMSGKEITVEHPDTKQVYNFIYDVSFWSFDECHPHYASQ    351 - 420
TTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGKSYTMMGFSEEPGIIPRFCEDLFSQVARKQTQEVSYHI    421 - 490
EMSFFEVYNEKIHDLLVCKDENGQRKQPLRVREHPVYGPYVEALSMNIVSSYADIQSWLELGNKQRATAA    491 - 560
TGMNDKSSRSHSVFTLVMTQTKTEFVEGEEHDHRITSRINLIDLAGSERCSTAHTNGDRLKEGVSINKSL    561 - 630
LTLGKVISALSEQANQRSVFIPYRESVLTWLLKESLGGNSKTAMIATISPAASNIEETLSTLRYANQARL    631 - 700
IVNIAKVNEDMNAKLIRELKAEIAKLKAAQRNSRNIDPERYRLCRQEITSLRMKLHQQERDMAEMQRVWK    701 - 770
EKFEQAEKRKLQETKELQKAGIMFQMDNHLPNLVNLNEDPQLSEMLLYMIKEGTTTVGKYKPNSSHDIQL    771 - 840
SGVLIADDHCTIKNFGGTVSIIPVGEAKTYVNGKHILEITVLRHGDRVILGGDHYFRFNHPVEVQKGKRP    841 - 910
SGRDTPISEGPKDFEFAKNELLMAQRSQLEAEIKEAQLKAKEEMMQGIQIAKEMAQQELSSQKAAYESKI    911 - 980
KALEAELREESQRKKMQEINNQKANHKIEELEKAKQHLEQEIYVNKKRLEMETLATKQALEDHSIRHARI    981 - 1050
LEALETEKQKIAKEVQILQQNRNNRDKTFTVQTTWSSMKLSMMIQEANAISSKLKTYYVFGRHDISDKSS   1051 - 1120
SDTSIRVRNLKLGISTFWSLEKFESKLAAMKELYESNGSNRGEDAFCDPEDEWEPDITDAPVSSLSRRRS   1121 - 1190
RSLMKNRRISGCLHDIQVHPIKNLHSSHSSGLMDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEE   1191 - 1260
RTIADSLINSFLKIYNGLFAISKAHEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVLMKHWLSDLLP   1261 - 1330
CTNIARLEDELRQEVKKLGGYLQLFLQGCCLDISSMIKEAQKNAIQIVQQAVKYVGQLAVLKGSKLHFLE   1331 - 1400
NGNNKAASVQEEFMDAVCDGVGLGMKILLDSGLEKAKELQHELFRQCTKNEVTKEMKTNAMGLIRSLENI   1401 - 1470
FAESKIKSFRRQVQEENFEYQDFKRMVNRAPEFLKLKHCLEKAIEIIISALKGCHSDINLLQTCVESIRN   1471 - 1540
LASDFYSDFSVPSTSVGSYESRVTHIVHQELESLAKSLLFCFESEESPDLLKPWETYNQNTKEEHQQSKS   1541 - 1610
SGIDGSKNKGVPKRVYELHGSSPAVSSEECTPSRIQWV                                   1611 - 1648
//

Text Mined References (40)

PMID Year Title
25528264 2014 The role of KIF14 in patient-derived primary cultures of high-grade serous ovarian cancer cells.
25348260 2014 Kinesin-14 and kinesin-5 antagonistically regulate microtubule nucleation by ?-TuRC in yeast and human cells.
25106407 2014 Sox17 inhibits hepatocellular carcinoma progression by downregulation of KIF14 expression.
24854087 2014 Silencing of KIF14 interferes with cell cycle progression and cytokinesis by blocking the p27(Kip1) ubiquitination pathway in hepatocellular carcinoma.
24784001 2014 KIF14 promotes AKT phosphorylation and contributes to chemoresistance in triple-negative breast cancer.
24626475 2014 Transcriptional and epigenetic regulation of KIF14 overexpression in ovarian cancer.
24128419 2014 Exome sequencing identifies mutations in KIF14 as a novel cause of an autosomal recessive lethal fetal ciliopathy phenotype.
23626713 2013 The motor protein KIF14 inhibits tumor growth and cancer metastasis in lung adenocarcinoma.
23479679 2013 A targeted RNAi screen of the breast cancer genome identifies KIF14 and TLN1 as genes that modulate docetaxel chemosensitivity in triple-negative breast cancer.
23414349 2013 Suppression of KIF14 expression inhibits hepatocellular carcinoma progression and predicts favorable outcome.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22999822 2013 Kinesin family member 14 is a candidate prognostic marker for outcome of glioma patients.
21618518 2012 Kinesin family member 14: an independent prognostic marker and potential therapeutic target for ovarian cancer.
21269460 2011 Initial characterization of the human central proteome.
20309963 2010 Novel interactors and a role for supervillin in early cytokinesis.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19609547 2009 Metal-proteinase ADAM12, kinesin 14 and checkpoint suppressor 1 as new molecular markers of laryngeal carcinoma.
19509238 2009 Consensus transcriptome signature of perineural invasion in pancreatic carcinoma.
19190782 2009 KIF14 and E2F3 mRNA expression in human retinoblastoma and its phenotype association.
19123481 2009 Three genetic developmental stages of papillary renal cell tumors: duplication of chromosome 1q marks fatal progression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17962437 2007 High expression of KIF14 in retinoblastoma: association with older age at diagnosis.
17545527 2007 KIF14 messenger RNA expression is independently prognostic for outcome in lung cancer.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
17099872 2007 Profiling genomic copy number changes in retinoblastoma beyond loss of RB1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16820410 2006 Novel function of beta-arrestin2 in the nucleus of mature spermatozoa.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16648480 2006 RNA interference-mediated silencing of mitotic kinesin KIF14 disrupts cell cycle progression and induces cytokinesis failure.
16570270 2006 KIF14 mRNA expression is a predictor of grade and outcome in breast cancer.
16431929 2006 KIF14 and citron kinase act together to promote efficient cytokinesis.
15897902 2005 KIF14 is a candidate oncogene in the 1q minimal region of genomic gain in multiple cancers.
15843429 2005 Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9275178 1997 Identification and classification of 16 new kinesin superfamily (KIF) proteins in mouse genome.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.