Property Summary

Ligand Count 602
NCBI Gene PubMed Count 119
PubMed Score 404.36
PubTator Score 261.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.3

Expression

  Differential Expression (32)

Disease log2 FC p
adrenocortical carcinoma 2.726 6.1e-05
adult high grade glioma 2.200 3.6e-05
Astrocytoma, Pilocytic 1.300 3.3e-05
Atopic dermatitis 1.500 2.1e-04
atypical teratoid / rhabdoid tumor 4.000 3.3e-12
Breast cancer 2.200 2.9e-14
breast carcinoma 1.700 2.6e-39
colon cancer 1.600 2.5e-03
ductal carcinoma in situ 2.300 1.7e-03
Endometriosis 2.177 8.1e-03
ependymoma 2.300 3.0e-09
glioblastoma 3.200 2.2e-12
group 3 medulloblastoma 4.000 1.6e-09
interstitial cystitis 1.300 2.5e-02
intraductal papillary-mucinous carcinoma... 2.700 5.8e-05
intraductal papillary-mucinous neoplasm ... 3.400 7.5e-04
invasive ductal carcinoma 3.000 6.4e-05
lung adenocarcinoma 1.100 6.6e-07
lung cancer 3.200 4.7e-04
malignant mesothelioma 1.300 1.0e-06
medulloblastoma, large-cell 4.300 3.4e-07
nasopharyngeal carcinoma 1.700 1.3e-04
non-small cell lung cancer 3.022 7.9e-30
oligodendroglioma 1.100 1.3e-04
osteosarcoma -2.260 2.0e-02
ovarian cancer 2.100 1.2e-04
pancreatic cancer 1.800 2.1e-06
pituitary cancer 1.500 2.1e-05
primary Sjogren syndrome 1.200 4.4e-02
primitive neuroectodermal tumor 3.800 5.2e-07
psoriasis 1.200 6.4e-28
ulcerative colitis 1.100 3.6e-03

PDB (48)

Gene RIF (99)

AA Sequence

MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFDM      1 - 70
VFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGIIPRTL     71 - 140
HQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEV    141 - 210
YQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDK    211 - 280
RAREAGNINQSLLTLGRVITALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTL    281 - 350
EYAHRAKNILNKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV    351 - 420
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEYITSALESTEE    421 - 490
KLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNSLFNNMEELIKDGSSKQKAML    491 - 560
EVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHVSQIFNMILKEQSLAAESKTVLQELINVLKT    561 - 630
DLLSSLEMILSPTVVSILKINSQLKHIFKTSLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVES    631 - 700
QKQCGNLTEDLKTIKQTHSQELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQ    701 - 770
KFCADSDGFSQELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER    771 - 840
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNETIKIGLTKLN    841 - 910
CFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLMMLNCSENNKEETIPDVDVEE    911 - 980
AVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGKDKENRGINTLERSKVEETTEHLVTKSRLPL    981 - 1050
RAQINL                                                                   1051 - 1056
//

Text Mined References (127)

PMID Year Title