Property Summary

NCBI Gene PubMed Count 12
PubMed Score 46.08
PubTator Score 11.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease -2.350 5.0e-03
active ulcerative colitis -2.434 3.4e-03
adult high grade glioma -1.500 4.5e-03
astrocytic glioma -1.200 1.7e-02
Astrocytoma, Pilocytic -1.100 4.2e-03
atypical teratoid / rhabdoid tumor -2.200 2.6e-03
ependymoma -1.900 2.9e-02
gastric carcinoma -1.300 2.3e-02
glioblastoma -1.900 1.5e-02
group 4 medulloblastoma 1.800 2.9e-04
intraductal papillary-mucinous adenoma (... -2.700 1.8e-04
intraductal papillary-mucinous carcinoma... -3.000 1.4e-04
intraductal papillary-mucinous neoplasm ... -2.900 2.6e-03
lung carcinoma 2.200 1.7e-38
medulloblastoma, large-cell -1.200 3.3e-03
oligodendroglioma -1.400 3.7e-08
osteosarcoma -1.185 1.8e-02
ovarian cancer -1.600 6.7e-07
subependymal giant cell astrocytoma -1.248 2.4e-02

Gene RIF (5)

AA Sequence

MDNQQDKAIVASANGENTLINGVKENDSEDQDVAMKSFAALEAAAPIQPTPVAQKETLMYPRGLLPLPSK      1 - 70
KPCMQSPPSPLGLIEAPEHAANSASVNAISLTSGIAKGLNTWSLPNECEKAPFAIMEPAGMSALNGDCLM     71 - 140
QPSRTCLGCFMESKDAVDPEPGISLKVGDLNRDYETCAVSDIGIQCINAGENMKYGEQLLSDQLLGFPLH    141 - 210
KSRAGDRRETEKPDIDLEDPAQKSYYEALLLDKCNTEEALLANSNQDWGYFETFISESKIELLDLCSKNE    211 - 280
LSVNLFSEEDVDNYMFDDDESTLGSDVCSLKIRYESFQDNVRDKTTLLMQEDAQFNFFPSVFTTCPKRES    281 - 350
KSGALKQSSDFSQFKVPDVSIIWGEEDKNLDKKKGKEEGQEDKGVEKKDGKDNGEKPALNKPCSGTEVEQ    351 - 420
LKNPKQGHLANSLETSGSFSDDSSFIEISYDAMGEIKDCSRYMARDTNSGSSSSQQNYGLRAKRKVRYSE    421 - 490
DYLYDVDSLEGEKVNERKEWLPVGSKEEDDDEWCPKKRRKVTRKEPPVIIKYIIINRFKGEKNMLVKLGK    491 - 560
VDASETTVNLSENQLNKYAKLAPLKGFWQKKKKQRNTNTDSIKTPFSQKQSFEPGSFEVSFLPPARKRKS    561 - 630
KLGNRHRIQRIPSIEISASSKQISLCNDQRHASNHKEDGGLKGTLKSAPLGAPSCANGSHLNDITGPDSV    631 - 700
KVKAQDTEFKGPERKVLNKIKFKSEARLKSKKVKAAGQESKPIVQMSPLLENQSSKANLKNEVIPGTSNS    701 - 770
SRLSEFHEAKAAKSSTFLPTTCSSEMPLSSANVTTNIPVIPGGYLQTLLDASDLSNNTSISYFSHHSPEQ    771 - 840
NEGSLTQTEKSFVPLQPTQDCVLTSSSDSELQQSSHNFKMESSNYRNVWPNKATSGTQEFMAEVSREIAP    841 - 910
TQSSEFGASQVVSMENNLTPTTYNPICLNSGGSNCNKVLYDSMQDTQLPSDDSYQLCHFNNGEICFPFQQ    911 - 980
GPVNMDDGRLFSFDSMAPLSVSSSNYCSLSLKSCEKDGDDDITDDFLAHCSPKLVIQQSIDEIAPLKEST    981 - 1050
DLLDISNFTPDKFRHSSLSEMSPPDTPSLSPQITRCESMKTLGTLKGFQEGVPGPLDSVEKIKWDCSTLS   1051 - 1120
RQVQMEDGFTLNNHQFQFHMFNDEDSVSLLQKNPCLSTFNDPSGQISTNNKVSKSRKKSSPSKSGAMNQS   1121 - 1190
SSQKNTRKKSLKGNNKGIEKPPGKNSRQVPKSTKKGKYMAAINGEKMQIGIGRGGSQTNTISSTGKTLAE   1191 - 1260
CIQHGGPMASMKMPSQKGLSGDWALGKESSPGWSDMSMGTNTNSLLDDDQREFQEPSYILSNIASGMADV   1261 - 1330
QRFMMASIEPLWEPMEHHGDPNIFYSPESNSLKLKTLKILAGTPQESKKKINSGSQGATKNHRSIKGVSK   1331 - 1400
SNGKTAIGDPGRANMPGYNEDSRSTFFDKKYSNMSTLGNNGPTHKKLYRHKSSSKALRDEKCKGKHMERE   1401 - 1470
QVHKDESGTASFEKLRDSDYNLLKAETTFWVLPVFEEETRIFQKDI                           1471 - 1516
//

Text Mined References (15)

PMID Year Title