Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.29
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.300 7.0e-05
astrocytic glioma -1.600 5.3e-03
Astrocytoma, Pilocytic -2.400 3.8e-09
atypical teratoid / rhabdoid tumor -1.200 4.2e-02
colon cancer -1.100 7.9e-05
ependymoma -2.200 2.2e-03
glioblastoma -2.100 3.1e-07
group 3 medulloblastoma -2.000 3.6e-03
medulloblastoma, large-cell -2.200 2.6e-04
oligodendroglioma -1.400 3.4e-03
primitive neuroectodermal tumor -1.400 1.4e-02

AA Sequence

MTSCGQQSLNVLAVLFSLLFSAVLSAHFRVCEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYC      1 - 70
CNETEFQAVMQANLTASSEGYMHNNYTALLGVWIYGFFVLMLLVLDLLYYSAMNYDICKVYLARWGIQGR     71 - 140
WMKQDPRRWGNPARAPRPGQRAPQPQPPPGPLPQAPQAVHTLRGDAHSPPLMTFQSSSA               141 - 199
//

Text Mined References (6)

PMID Year Title