Property Summary

NCBI Gene PubMed Count 104
PubMed Score 119.65
PubTator Score 238.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.345 1.1e-03
atypical teratoid / rhabdoid tumor 1.200 2.7e-09
glioblastoma 1.200 1.1e-05
group 3 medulloblastoma 1.200 9.8e-05
intraductal papillary-mucinous neoplasm ... 2.000 6.6e-03
medulloblastoma, large-cell 1.900 7.4e-05
non primary Sjogren syndrome sicca -1.400 2.4e-02
non-small cell lung cancer 1.176 3.0e-11
osteosarcoma -1.681 3.0e-03
pituitary cancer 1.200 1.2e-04
primitive neuroectodermal tumor 1.400 3.1e-03
psoriasis 1.200 7.5e-43

Gene RIF (93)

AA Sequence

MDSTACLKSLLLTVSQYKAVKSEANATQLLRHLEVISGQKLTRLFTSNQILTSECLSCLVELLEDPNISA      1 - 70
SLILSIIGLLSQLAVDIETRDCLQNTYNLNSVLAGVVCRSSHTDSVFLQCIQLLQKLTYNVKIFYSGANI     71 - 140
DELITFLIDHIQSSEDELKMPCLGLLANLCRHNLSVQTHIKTLSNVKSFYRTLITLLAHSSLTVVVFALS    141 - 210
ILSSLTLNEEVGEKLFHARNIHQTFQLIFNILINGDGTLTRKYSVDLLMDLLKNPKIADYLTRYEHFSSC    211 - 280
LHQVLGLLNGKDPDSSSKVLELLLAFCSVTQLRHMLTQMMFEQSPPGSATLGSHTKCLEPTVALLRWLSQ    281 - 350
PLDGSENCSVLALELFKEIFEDVIDAANCSSADRFVTLLLPTILDQLQFTEQNLDEALTRKKCERIAKAI    351 - 420
EVLLTLCGDDTLKMHIAKILTTVKCTTLIEQQFTYGKIDLGFGTKVADSELCKLAADVILKTLDLINKLK    421 - 490
PLVPGMEVSFYKILQDPRLITPLAFALTSDNREQVQSGLRILLEAAPLPDFPALVLGESIAANNAYRQQE    491 - 560
TEHIPRKMPWQSSNHSFPTSIKCLTPHLKDGVPGLNIEELIEKLQSGMVVKDQICDVRISDIMDVYEMKL    561 - 630
STLASKESRLQDLLETKALALAQADRLIAQHRCQRTQAETEARTLASMLREVERKNEELSVLLKAQQVES    631 - 700
ERAQSDIEHLFQHNRKLESVAEEHEILTKSYMELLQRNESTEKKNKDLQITCDSLNKQIETVKKLNESLK    701 - 770
EQNEKSIAQLIEKEEQRKEVQNQLVDREHKLANLHQKTKVQEEKIKTLQKEREDKEETIDILRKELSRTE    771 - 840
QIRKELSIKASSLEVQKAQLEGRLEEKESLVKLQQEELNKHSHMIAMIHSLSGGKINPETVNLSI         841 - 905
//

Text Mined References (112)

PMID Year Title