Property Summary

NCBI Gene PubMed Count 93
PubMed Score 103.99
PubTator Score 238.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.681 3.0e-03
group 3 medulloblastoma 1.500 5.9e-04
atypical teratoid / rhabdoid tumor 1.200 2.7e-09
glioblastoma 1.200 1.1e-05
medulloblastoma, large-cell 1.900 7.4e-05
primitive neuroectodermal tumor 1.400 3.1e-03
adrenocortical carcinoma 1.345 1.1e-03
non-small cell lung cancer 1.176 3.0e-11
intraductal papillary-mucinous neoplasm ... 2.000 6.6e-03
non primary Sjogren syndrome sicca -1.400 2.4e-02
pituitary cancer 1.200 1.2e-04
psoriasis 1.200 7.5e-43

Gene RIF (82)

PMID Text
26823836 patients with a stronger expression of CIP2A in tgastric umor tissues had no significant relationship with these genes that are related to gastric cancer chemotherapy drug resistance
26813457 CIP2A levels were significantly associated with the American Joint Committee on Cancer (AJCC) stage, histological grade and lymph node metastasis in breast cancer patients.
26560124 CIP2A is a tumor-associated autoantigen in lung cancer, which promote lung cancer proliferation partially through MKK4/7-JNK signaling pathway.
26522733 CIP2A was detected in tongue cancer and tongue hyperplasia, whereas local inflammation was stronger in cancer, CIP2A expression was increased in metastasized cancer compared to non-metastasized
26327467 CIP2A is a critical oncoprotein involved in cell invasion and epithelial mesenchymal transition in clear cell renal carcinoma.
26234767 Alterations affecting PP2A subunits together with the deregulation of endogenous PP2A inhibitors such as CIP2A and SET have been described as contributing mechanisms to inactivate PP2A in prostate cancer.
25965834 Identify CIP2A as a common denominator for androgen receptor-signaling and prostate cancer stem cell functionality, and suggest as possible therapeutic target.
25896895 CIP2A is an independent prognostic marker in patients with wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy.
25833693 we provide a novel therapeutic mechanism for inhibiting CIP2A function in cancerous cells via targeting the CIP2A-LRRC59 interaction.
25765543 High cancerous inhibitor of PP2A (CIP2A) protein levels at diagnosis of chronic myeloid leukaemia are associated with disease progression in imatinib-treated patients
25736928 our findings strongly suggest that CIP2A promotes cell cycle progression, premature chromosome segregation, and aneuploidy, possibly through a novel interaction with Sgol1.
25636449 our data showed that the depletion of CIP2A expression in PCa cell line DU-145 resulted in reduced c-MYC protein levels
25560487 CIP2A knockdown led to substantial reductions in c-Myc levels in PCa cell lines, but no significant change in phosphorylated Akt expression after CIP2A knockdown in DU-145 cells.
25537503 Data show that afatinib reduced Elk-1 transcription factor binding to the CIP2A protein promoter and suppressed CIP2A transcription.
25474139 CIP2A is an Oct4 target gene involved in head and neck squamous cell cancer oncogenicity and radioresistance
25458953 High CIP2A expression is associated with cervical-cancer progression.
25377160 CIP2A silencing led to decreased proliferation.
25325377 CIP2A regulates cancer metabolism and CREB phosphorylation in non-small cell lung cancer
25228280 Inhibition of CIP2A determines the effects of tamoxifen-induced apoptosis in estrogen receptor-negative breast cancer cells.
25187431 Which increased PP2A activity.
25109354 study addressed a novel role of CIP2A in mediating lung cancer progression through interacting with the AKT-mTOR signaling pathway.
25086622 CIP2A as a crucial oncoprotein has been involved in cell proliferation and apoptosis, which may serve as a therapeutic target in breast cancer treatment.
25023053 CIP2A is overexpressed in chronic myelocytic leukemia patients.Cip2a plays an important role in the pathogenesis of chronic myelocytic leukemia.
25015035 Studies indicate that oncoprotein CIP2A (KIAA1524) controls oncogenic cellular signals by suppressing protein phosphatase 2A (PP2A).
25012485 findings indicate tumor suppressor protein PP2A and its inhibitor CIP2A are widely distributed in meningiomas with a tendency for higher CIP2A expression in at least some higher-grade meningiomas; findings raise the possibility that CIP2A may participate in biology of meningiomas
24954871 The CIP2A-dependent pathway mediates the tumoricidal effects of erlotinib on NSCLC cells without EGFR mutations in vitro and in vivo.
24927563 SET is overexpressed in about 50-60% and CIP2A in about 90% of breast cancers.
24884612 Downregulation of CIP2A suppresses cell proliferation and growth of nasopharyngeal carcinoma.
24874844 overexpression of CIP2A diminished NSCLC cell chemosensitivity to cisplatin by inducing activation of Akt pathway, suggesting critical roles of CIP2A in NSCLC cell chemoresistance to cisplatin
24839010 miR-218 is downregulated in melanoma. By targeting CIP2A and BMI1, miR-218 regulates the proliferation, migration, and invasion of the melanoma cell lines A375 and SK-MEL-2.
24590173 CIP2A is a distinct regulator of mTORC1 and mTORC1-dependent control of CIP2A degradation is a mechanism that links mTORC1 activity with c-Myc stability to coordinate cellular metabolism, growth, and proliferation.
24493623 High CIP2A expression is associated with drug resistance in colon cancer.
24399648 p90/CIP2A can induce autoantibody response in sera from patients with breast cancer
24398514 These findings suggest that H. pylori-induced upregulation of CIP2A contributes to the development and progression of gastric cancer.
24369732 Downregulation of CIP2A attenuates migration and metastatic potential of cutaneous malignant melanoma cells.
24280132 Estradiol enhances CIP2A expression by the activation of p70 S6 kinase.
24214971 CIP2A strongly interacts with NEK2 during G2/M phase, thereby enhancing NEK2 kinase activity to facilitate centrosome separation in a PP1- and PP2A-independent manner.
24204027 CIP2A is a novel anticancer target based on PP2A reactivation and inhibition of the oncogenic activity of its downstream effectors.[review]
24163288 The expression levels of mRNA for CIP2A and PP2A exhibited positive correlation in MDS/control bone marrow.
24098375 Expression of CIP2A was found to be dependent on MAPK activity, linking elevated c-Myc expression to deregulated signal transduction in colon cancer
24019920 599 peptide-mediated siRNA delivery promoted significant CIP2A mRNA and protein silencing which resulted in decreased oral cancer cell invasiveness and anchorage-independent growth
24014087 our data identified CIP2A as a critical oncoprotein involved in cell proliferation and invasion, which could serve as a therapeutic target in osteosarcoma.
23983103 A novel function for CIP2A in facilitating the stability and activity of the pivotal mitotic kinase Plk1 in cell-cycle progression and tumor development.
23802697 CIP2A immunoreactivity was usually weak or absent in indolent B-cell lymphomas, but moderately positive or strongly positive in almost all aggressive lymphomas, such as DLBCL, BL, and BCLU.
23743567 Cox-regression analysis showed that IL-10 and CIP2A mRNA levels may independently predict survival in patients with lung adenocarcinoma, especially in patients with E6-positive tumors
23568706 results indicate that CIP2A expressioncorrelates with altered expression of epithelial-mesenchymal transition markers, increased lymph node metastasis, and poorer survival in pancreatic ductal adenocarcinoma
23552692 Tumor suppressor miR-375 regulates MYC expression via repression of CIP2A coding sequence through multiple miRNA-mRNA interactions.
23471718 CIP2A expression may be a potential biomarker for chemotherapeutic sensitivity and prognosis of breast cancer.
23467938 These results validate the role of CIP2A as a clinically relevant oncoprotein and establish CIP2A as a promising therapeutic target of astrocytoma.
23455633 show that CIP2A expression in rheumatoid arthritis FLS is an important mediator of dysfunctional apoptosis independent of c-Myc stabilization
23383345 Cancerous inhibitor of protein phosphatase 2A mediates bortezomib-induced autophagy in hepatocellular carcinoma independent of proteasome.
23342256 CIP2A is an oncogene involved in bladder cancer as it is specifically expressed in bladder tumor tissue and not normal tissue.
23306062 Data show that E2F1 overexpression, due to p53 or p21 inactivation, promotes expression of human oncoprotein CIP2A.
23275123 Our findings suggest that CIP2A is an independent predictor of poor prognosis of bladder urothelial cell carcinoma patients
23178652 CIP2A may be useful as a therapeutic biomarker for predicting clinical response to erlotinib in hepatocellular carcinoma treatment.
23117818 The binding of Ets1 and Elk1 together to the proximal CIP2A promoter is absolutely required for CIP2A expression in cervical, endometrial and liver carcinoma cell lines
22923389 CIP2A overexpression is associated with ovarian cancer.
22847158 CIP2A overexpression may be useful as an independent prognostic biomarker for overall survival and disease-free survival of hepatocellular carcinoma.
22537901 CIP2A is a major determinant mediating bortezomib-induced apoptosis in triple negative breast cancer cells.
22537152 Data suggest that nontumoral cancerous inhibitor of protein phosphatase 2A (CIP2A)mRNA expression might serve as a novel biomarker for HCC patients undergoing resection.
22310977 Overexpression of CIP2A in colorectal cancer patients may be an important step in colorectal carcinogenesis. Based on findings, CIP2A shows no association with patient prognosis in colorectal cancer, but is associated with nuclear c-Myc.
22249265 The results both validated CIP2A's role in regulating MYC-mediated gene expression and provided a plausible novel explanation for the high MYC activity in basal-like and HER2thorn breast cancers.
22085493 Bortezomib sensitized solid tumor cells to radiation-induced apoptosis through the inhibition of CIP2A.
22075943 Higher-CIP2A expression positively correlates with the aggressive phenotype of RCCs, and predicts poor prognosis for patients
22072119 CIP2A expression is elevated in cervical cancer.
21897396 High Cancerous inhibitor of protein phosphatase 2A is associated with serous ovarian cancer.
21874565 CIP2A expression in Chinese non-small-cell lung cancer patients may be a useful biomarker of biological malignancy
21655278 Silencing CIP2A by siRNA inhibited the proliferation and clonogenic activity of lung cancer cells.
21575984 CIP2A plays an important role in carcinogenisis of cervical cancer and shows promise for the diagnosis and treatment of cervical cancer.
21490338 CIP2A is biologically and clinically important in chronic myeloid leukemia and may be a novel therapeutic target.
21479604 The data demonstrated that CIP2A expression is closely associated with the histopathological score of synovitis and invasive function of fibroblast-like synoviocytes in rheumatoid arthritis.
21445343 results also suggest that in addition to its established role in invasion and angiogenesis, ETS1 may support malignant cellular growth via regulation of CIP2A expression and protein phosphatase 2A inhibition
21219591 The high expression of CIP2A in HL60 cells may be related to active cell proliferation and arrest of cell differentiation.
21140243 CIP2A is significantly overexpressed in human esophageal tumors
21068540 Data suggest that CIP2A may play a significant role in oral malignant transformation and therefore, it may be a potential target for chemotherapy of OSCC.
20964854 Expression of the CIP2A protein is increased in prostate cancer specimens and its expression is associated with poorly differentiated and high-risk tumors.
20842459 Overexpression of CIP2A is associated with non-small cell lung cancer.
19959630 CagA upregulated CIP2A expression and this upregulation effect was dependent on Src and Ras/mitogen-activated protein kinase kinase/extracellular signal-regulated kinase pathways.
19671842 CIP2A is associated with clinical aggressivity in human breast cancer and promotes the malignant growth of breast cancer cells.
19470954 CIP2A and MYC appear to be regulated in a positive feedback loop, wherein they promote each other's expression and gastric cancer cell proliferation.
18559589 CIP2A in tumor cells is required for sustained proliferation by preventing cell growth arrest, senescence, or differentiation.
17632056 Data show that CIP2A/KIAA1524 is a human oncoprotein that inhibits protein phosphatase 2A and stabilizes c-Myc in human malignancies.

AA Sequence

MDSTACLKSLLLTVSQYKAVKSEANATQLLRHLEVISGQKLTRLFTSNQILTSECLSCLVELLEDPNISA      1 - 70
SLILSIIGLLSQLAVDIETRDCLQNTYNLNSVLAGVVCRSSHTDSVFLQCIQLLQKLTYNVKIFYSGANI     71 - 140
DELITFLIDHIQSSEDELKMPCLGLLANLCRHNLSVQTHIKTLSNVKSFYRTLITLLAHSSLTVVVFALS    141 - 210
ILSSLTLNEEVGEKLFHARNIHQTFQLIFNILINGDGTLTRKYSVDLLMDLLKNPKIADYLTRYEHFSSC    211 - 280
LHQVLGLLNGKDPDSSSKVLELLLAFCSVTQLRHMLTQMMFEQSPPGSATLGSHTKCLEPTVALLRWLSQ    281 - 350
PLDGSENCSVLALELFKEIFEDVIDAANCSSADRFVTLLLPTILDQLQFTEQNLDEALTRKKCERIAKAI    351 - 420
EVLLTLCGDDTLKMHIAKILTTVKCTTLIEQQFTYGKIDLGFGTKVADSELCKLAADVILKTLDLINKLK    421 - 490
PLVPGMEVSFYKILQDPRLITPLAFALTSDNREQVQSGLRILLEAAPLPDFPALVLGESIAANNAYRQQE    491 - 560
TEHIPRKMPWQSSNHSFPTSIKCLTPHLKDGVPGLNIEELIEKLQSGMVVKDQICDVRISDIMDVYEMKL    561 - 630
STLASKESRLQDLLETKALALAQADRLIAQHRCQRTQAETEARTLASMLREVERKNEELSVLLKAQQVES    631 - 700
ERAQSDIEHLFQHNRKLESVAEEHEILTKSYMELLQRNESTEKKNKDLQITCDSLNKQIETVKKLNESLK    701 - 770
EQNEKSIAQLIEKEEQRKEVQNQLVDREHKLANLHQKTKVQEEKIKTLQKEREDKEETIDILRKELSRTE    771 - 840
QIRKELSIKASSLEVQKAQLEGRLEEKESLVKLQQEELNKHSHMIAMIHSLSGGKINPETVNLSI         841 - 905
//

Text Mined References (101)

PMID Year Title
26823836 2015 Relationship between CIP2A expression, and prognosis and MDR-related proteins in patients with advanced gastric cancer.
26813457 2016 Clinical significance of sCIP2A levels in breast cancer.
26560124 2015 CIP2A overexpression induces autoimmune response and enhances JNK signaling pathway in human lung cancer.
26522733 2015 The association and prognostic relevance of cancerous inhibitor of protein phosphatase 2A and inflammation in tongue squamous cell carcinoma.
26327467 2015 Overexpression of CIP2A in clear cell renal cell carcinoma promotes cellular epithelial-mesenchymal transition and is associated with poor prognosis.
26234767 2015 PP2A inhibition as a novel therapeutic target in castration-resistant prostate cancer.
25965834 2015 CIP2A is a candidate therapeutic target in clinically challenging prostate cancer cell populations.
25896895 2015 Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy.
25833693 2015 Leucine-rich repeat-containing protein 59 mediates nuclear import of cancerous inhibitor of PP2A in prostate cancer cells.
25765543 2015 Second generation tyrosine kinase inhibitors prevent disease progression in high-risk (high CIP2A) chronic myeloid leukaemia patients.
25736928 2015 Cancerous inhibitor of protein phosphatase 2A promotes premature chromosome segregation and aneuploidy in prostate cancer cells through association with shugoshin.
25636449 2015 CIP2A mediates prostate cancer progression via the c-Myc signaling pathway.
25560487 2015 CIP2A mediates prostate cancer progression via the c-MYC signaling pathway.
25537503 2015 Afatinib induces apoptosis in NSCLC without EGFR mutation through Elk-1-mediated suppression of CIP2A.
25474139 2015 CIP2A is an Oct4 target gene involved in head and neck squamous cell cancer oncogenicity and radioresistance.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25458953 2015 CIP2A cooperates with H-Ras to promote epithelial-mesenchymal transition in cervical-cancer progression.
25377160 2015 Knockdown of cancerous inhibitor of protein phosphatase 2A may sensitize metastatic castration-resistant prostate cancer cells to cabazitaxel chemotherapy.
25325377 2015 CIP2A regulates cancer metabolism and CREB phosphorylation in non-small cell lung cancer.
25228280 2014 Tamoxifen induces apoptosis through cancerous inhibitor of protein phosphatase 2A-dependent phospho-Akt inactivation in estrogen receptor-negative human breast cancer cells.
25187431 2014 TD-19, an erlotinib derivative, induces epidermal growth factor receptor wild-type nonsmall-cell lung cancer apoptosis through CIP2A-mediated pathway.
25109354 2014 CIP2A regulates cell proliferation via the AKT signaling pathway in human lung cancer.
25086622 2014 p90/CIP2A mediates breast cancer cell proliferation and apoptosis.
25023053 2014 CIP2A is overexpressed and involved in the pathogenesis of chronic myelocytic leukemia by interacting with breakpoint cluster region-Abelson leukemia virus.
25015035 2014 Oncogenic nexus of cancerous inhibitor of protein phosphatase 2A (CIP2A): an oncoprotein with many hands.
25012485 2014 CIP2A and PP2A in human leptomeninges, arachnoid granulations and meningiomas.
24954871 2014 CIP2A mediates erlotinib-induced apoptosis in non-small cell lung cancer cells without EGFR mutation.
24927563 2014 Targeting c-MYC by antagonizing PP2A inhibitors in breast cancer.
24884612 2014 Overexpression of CIP2A is an independent prognostic indicator in nasopharyngeal carcinoma and its depletion suppresses cell proliferation and tumor growth.
24874844 2014 Knockdown of cancerous inhibitor of protein phosphatase 2A may sensitize NSCLC cells to cisplatin.
24839010 2014 Expression patterns of microRNA-218 and its potential functions by targeting CIP2A and BMI1 genes in melanoma.
24590173 2014 CIP2A oncoprotein controls cell growth and autophagy through mTORC1 activation.
24493623 2014 Temsirolimus enhances the efficacy of cetuximab in colon cancer through a CIP2A-dependent mechanism.
24399648 2014 Autoantibody response to a novel tumor-associated antigen p90/CIP2A in breast cancer immunodiagnosis.
24398514 2014 Helicobacter pylori enhances CIP2A expression and cell proliferation via JNK2/ATF2 signaling in human gastric cancer cells.
24369732 2014 Expression and prognostic significance of CIP2A in cutaneous malignant melanoma.
24280132 2014 Estradiol enhances CIP2A expression by the activation of p70 S6 kinase.
24214971 2014 Cancerous inhibitor of protein phosphatase 2A (CIP2A) protein is involved in centrosome separation through the regulation of NIMA (never in mitosis gene A)-related kinase 2 (NEK2) protein activity.
24204027 2013 Cancerous inhibitor of protein phosphatase 2A, an emerging human oncoprotein and a potential cancer therapy target.
24163288 2014 Over-expression of cancerous inhibitor of PP2A (CIP2A) in bone marrow cells from patients with a group of high-risk myelodysplastic syndromes.
24098375 2013 CIP2A influences survival in colon cancer and is critical for maintaining Myc expression.
24019920 2013 Fusogenic-oligoarginine peptide-mediated delivery of siRNAs targeting the CIP2A oncogene into oral cancer cells.
24014087 2014 CIP2A is overexpressed in osteosarcoma and regulates cell proliferation and invasion.
23983103 2013 CIP2A modulates cell-cycle progression in human cancer cells by regulating the stability and activity of Plk1.
23802697 2013 Increased expression of CIP2A in aggressive subtypes of B-cell lymphoma.
23743567 2013 IL-10 promotes tumor aggressiveness via upregulation of CIP2A transcription in lung adenocarcinoma.
23568706 2013 CIP2A expression is associated with altered expression of epithelial-mesenchymal transition markers and predictive of poor prognosis in pancreatic ductal adenocarcinoma.
23552692 2013 Tumor suppressor miR-375 regulates MYC expression via repression of CIP2A coding sequence through multiple miRNA-mRNA interactions.
23471718 2013 Clinical implications of CIP2A protein expression in breast cancer.
23467938 2013 Expression and biological role of CIP2A in human astrocytoma.
23455633 2013 CIP2A facilitates apoptotic resistance of fibroblast-like synoviocytes in rheumatoid arthritis independent of c-Myc expression.
23383345 2013 Cancerous inhibitor of protein phosphatase 2A mediates bortezomib-induced autophagy in hepatocellular carcinoma independent of proteasome.
23342256 2012 CIP2A protein expression in high-grade, high-stage bladder cancer.
23306062 2013 Senescence sensitivity of breast cancer cells is defined by positive feedback loop between CIP2A and E2F1.
23275123 2013 CIP2A is a predictor of survival and a novel therapeutic target in bladder urothelial cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178652 2013 Inhibition of CIP2A determines erlotinib-induced apoptosis in hepatocellular carcinoma.
23117818 Ets1 and Elk1 transcription factors regulate cancerous inhibitor of protein phosphatase 2A expression in cervical and endometrial carcinoma cells.
22923389 2012 CIP2A is overexpressed in human ovarian cancer and regulates cell proliferation and apoptosis.
22847158 2012 CIP2A is highly expressed in hepatocellular carcinoma and predicts poor prognosis.
22537901 2012 CIP2A is a target of bortezomib in human triple negative breast cancer cells.
22537152 2012 Expression and prognostic significance of CIP2A mRNA in hepatocellular carcinoma and nontumoral liver tissues.
22310977 2012 CIP2A overexpression is associated with c-Myc expression in colorectal cancer.
22249265 2012 CIP2A signature reveals the MYC dependency of CIP2A-regulated phenotypes and its clinical association with breast cancer subtypes.
22085493 2012 Bortezomib enhances radiation-induced apoptosis in solid tumors by inhibiting CIP2A.
22075943 2011 Expression of CIP2A in renal cell carcinomas correlates with tumour invasion, metastasis and patients' survival.
22072119 CIP2A expression is elevated in cervical cancer.
21897396 2011 Prognostic role of CIP2A expression in serous ovarian cancer.
21874565 2012 CIP2A with survivin protein expressions in human non-small-cell lung cancer correlates with prognosis.
21655278 2011 Overexpression and small molecule-triggered downregulation of CIP2A in lung cancer.
21575984 2011 Cancerous inhibitor of protein phosphatase 2A is overexpressed in cervical cancer and upregulated by human papillomavirus 16 E7 oncoprotein.
21490338 2011 Cancerous inhibitor of PP2A (CIP2A) at diagnosis of chronic myeloid leukemia is a critical determinant of disease progression.
21479604 2012 CIP2A expression is associated with synovial hyperplasia and invasive function of fibroblast-like synoviocytes in rheumatoid arthritis.
21445343 2011 ETS1 mediates MEK1/2-dependent overexpression of cancerous inhibitor of protein phosphatase 2A (CIP2A) in human cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21219591 2011 CIP2A is over-expressed in acute myeloid leukaemia and associated with HL60 cells proliferation and differentiation.
21140243 2012 CIP2A is overexpressed in esophageal squamous cell carcinoma.
21068540 2010 CIP2A expression and localization in oral carcinoma and dysplasia.
20964854 2010 CIP2A expression is increased in prostate cancer.
20842459 2011 CIP2A is overexpressed in non-small cell lung cancer and correlates with poor prognosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19959630 2010 Helicobacter pylori CagA upregulation of CIP2A is dependent on the Src and MEK/ERK pathways.
19671842 2009 CIP2A is associated with human breast cancer aggressivity.
19470954 2009 MYC-dependent regulation and prognostic role of CIP2A in gastric cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18559589 2008 CIP2A is overexpressed in gastric cancer and its depletion leads to impaired clonogenicity, senescence, or differentiation of tumor cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17632056 2007 CIP2A inhibits PP2A in human malignancies.
16381901 2006 The LIFEdb database in 2006.
15538718 2005 Preferential humoral immune response in prostate cancer to cellular proteins p90 and p62 in a panel of tumor-associated antigens.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118381 2002 Cloning and characterization of a novel 90 kDa 'companion' auto-antigen of p62 overexpressed in cancer.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.