Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.70
PubTator Score 10.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -2.400 5.3e-04
astrocytic glioma -2.100 3.0e-03
Astrocytoma, Pilocytic -1.200 6.1e-03
atypical teratoid / rhabdoid tumor -2.500 2.7e-05
Breast cancer 1.100 9.8e-08
breast carcinoma -1.200 1.8e-03
colon cancer -1.200 1.3e-02
cystic fibrosis 1.655 1.9e-04
ependymoma -2.100 5.8e-03
gastric carcinoma 1.200 3.0e-02
glioblastoma -1.800 3.4e-05
group 4 medulloblastoma -2.100 1.1e-03
intraductal papillary-mucinous adenoma (... -2.600 2.6e-05
intraductal papillary-mucinous carcinoma... -2.600 5.1e-05
intraductal papillary-mucinous neoplasm ... -2.400 2.0e-03
invasive ductal carcinoma -1.400 1.3e-02
lung adenocarcinoma -1.500 2.4e-14
lung cancer -2.400 1.6e-04
lung carcinoma -1.500 1.0e-06
malignant mesothelioma -8.400 2.3e-10
medulloblastoma, large-cell -2.400 4.4e-03
nephrosclerosis 1.344 5.4e-04
non-small cell lung cancer -1.933 2.0e-15
oligodendroglioma -1.300 2.2e-02
osteosarcoma -1.880 1.5e-02
ovarian cancer -1.700 1.2e-05
primitive neuroectodermal tumor -2.000 1.9e-03
psoriasis -1.800 2.0e-04

Synonym

Accession Q9P266 Q5HYA7 Q5T992 Q86WZ9 Q9BYJ2 JCAD
Symbols KIAA1462

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MYSVEDLLISHGYKLSRDPPASREDNPKGRQAARTGTRAGQGLQNGHEDGPAALAHRKTSAGKGHVSDSE      1 - 70
SRRSTPRGHGEPQSTSASRTSEAGFCNQPPSAWSSHPPTGNDQAYRRRGRQEARSQKPREHENLEARGMA     71 - 140
QAHSLPVHVREGPWEVGGRSEHVMKKPVWEEELRMSGPAKWQNVSLESWNQPRKLGRQMSDGDGERLFQD    141 - 210
LYPFIQGEHVLNSQNKGKSRSLPRVLSPESLSCTEIPIPLNERHSPKMPPYPPTCAPNLDSTRNSEKSGC    211 - 280
SAPFPRPKFGRPLKPPSYSSHQQSRGGADSSDSQDSQQMDAYVPRHELCLSDPGLEPPVYVPPPSYRSPP    281 - 350
QNIPNPYLEDTVPINVCGGHSQQQSPTEKAGASGQPPSGPPGTGNEYGVSPRLPQGLPAHPRPVTAYDGF    351 - 420
VQYIPFDDPRLRHFKLAQPQGFCEDIKLDDKSYNSSPVTAQEPAHGGMQPDGAIWNPQSLIPPSGDERGL    421 - 490
VLADSSPRWLWGQPPGDGENSGLPNQRDRCVARGQWPDVRGSQHGHTGRQVSSPYSQGESTCETQTKLKK    491 - 560
FQTGTRTKKSSKKKMNETIFCLVSIPVKSESHLPDRDMDNNDLKPSADQKNGSDKSPALQEQSLLSMSST    561 - 630
DLELQALTGSMGGRTEFQKQDLGEPEEDRQTNDLSFIHLTKHRELKHSGSWPGHRYRDQQTQTSFSEEPQ    631 - 700
SSQLLPGAKLGGPSRAALSPKCSDPAASEAQTHTAFPTGDHKQRPSARNLKGHRSLSPSSNSAFSRTSLS    701 - 770
VDQAPTPKAGRSQPCVDVHGLGAHPGPKREVVKGEPTGPCNSKQLFGQFLLKPVSRRPWDLISQLESFNK    771 - 840
ELQEEEESSSSSSSSSSSSEESEAEPQQENRAHCRQEDVGFRGNSPEMRVEPQPRMWVPESPVCRSGRGE    841 - 910
SKSESWSEELQPGHPRAWPPSPGRFRVEEGGGAPFCSADGSTSAEKRHLEVSNGMDELAGSPFPVTRMSS    911 - 980
RSSDAKPLPASYPAEPREPQESPKITSAFSSVKPSEAVPRKFDSGGERGAGLPLSLSNKNRGLSAPDLRS    981 - 1050
VGLTPGQEQGASELEGSLGEASTIEIPPGESLQARAARILGIEVAVESLLPGIRRAGQNQPAEPDASACT   1051 - 1120
PESPQEELLSRPAPADVPRVSTDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTDPVPE   1121 - 1190
PEPSPLESKFFEQKDVETKPPFRSTLFHFVERTPSVAGSEKRLRSPSKVIESLQEKLASPPRRADPDRLM   1191 - 1260
RMKEVSSVSRMRVLSFRNADSQEDAEELKATTRGQAGLPGGLVSPGSGDRAQRLGHSLSVSKDSISREEK   1261 - 1330
EHPAAQKEKSMDQDFWCPDSYDPSRVERV                                            1331 - 1359
//

Text Mined References (17)

PMID Year Title