Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 2.3e-03
psoriasis -2.400 7.6e-05
osteosarcoma -1.135 4.5e-05
ependymoma -1.900 9.0e-10
glioblastoma -2.700 8.7e-08
medulloblastoma -2.200 3.2e-05
atypical teratoid / rhabdoid tumor -2.800 4.8e-11
medulloblastoma, large-cell -2.000 8.4e-04
primitive neuroectodermal tumor -2.800 8.3e-06
intraductal papillary-mucinous adenoma (... -1.100 4.4e-03
lung cancer 1.400 9.1e-03
interstitial cystitis -1.600 1.2e-03
pediatric high grade glioma -2.300 3.4e-05
pilocytic astrocytoma -2.300 1.4e-08
subependymal giant cell astrocytoma -4.770 4.3e-03
Breast cancer -3.100 2.4e-21
invasive ductal carcinoma -1.100 1.7e-02
pituitary cancer 1.400 1.1e-06

Synonym

Accession Q8N9K7
Symbols TRM9L
C8orf79

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
23381944 Study links hTRM9L and tRNA modifications to inhibition of tumour growth via LIN9 and HIF1-alpha-dependent mechanisms.

AA Sequence

MQKQLLPLAAGQRCDYSQRESCCQSPHRAESAGDRSTDNGLHRGAERSFCCALDPLPRRPPAGRRGRDRS      1 - 70
SSACPGARARVWPPGACASFRDSHKRFIMRRTALFHFTPTSFHLRYTLRKL                        71 - 121
//

Text Mined References (12)

PMID Year Title
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23381944 2013 A human tRNA methyltransferase 9-like protein prevents tumour growth by regulating LIN9 and HIF1-?.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.