Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.600 2.4e-03
ependymoma -3.400 5.0e-04
oligodendroglioma -2.600 1.1e-17
glioblastoma -2.600 7.2e-04
medulloblastoma -4.300 2.3e-07
atypical teratoid / rhabdoid tumor -3.700 1.9e-05
medulloblastoma, large-cell -4.900 4.2e-04
primitive neuroectodermal tumor -3.700 6.0e-04
tuberculosis and treatment for 3 months -1.300 5.8e-05
non-small cell lung cancer -2.155 2.8e-17
lung adenocarcinoma -1.800 1.0e-11
nasopharyngeal carcinoma -2.200 1.6e-07
psoriasis -1.100 2.4e-08
ductal carcinoma in situ 1.300 1.4e-03
ovarian cancer 2.200 2.1e-06
pituitary cancer -1.300 3.6e-04

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MISTRVMDIKLREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGP      1 - 70
VGYDSEDELEESRGTLGSRALSHDSIFIPESGQDATRPVRVFSQENVCDRIKALQLKIQCNVKMGPPPPP     71 - 140
GGLPAKRGEDAGMSSEDDGLPRSPPEMSLLHDVGPGTTIKVSVVSPDHVSDSTVSARISDNSLAPVADFS    141 - 210
YPAESSSCLDNSAAKHKLQVKPRNQRSSKMRRLSSRAQSESLSDLTCTPEEEENEEKPLLEVSPEERPSS    211 - 280
GQQDVAPDRGPEPGPPAPLPPPGGARARRARLQHSSALTASVEEGGVPGEDPSSRPATPELAEPESAPTL    281 - 350
RVEPPSPPEGPPNPGPDGGKQDGEAPPAGPCAPATDKAEEVVCAPEDVASPFPTAIPEGDTTPPETDPAA    351 - 420
TSEAPSARDGPERSVPKEAEPTPPVLPDEEKGPPGPAPEPEREAETEPERGAGTEPERIGTEPSTAPAPS    421 - 490
PPAPKSCLKHRPAAASEGPAASPPLAAAESPPVEPGPGSLDAEAAAPERPKAERAEAPPAGAERAAPERK    491 - 560
AERGGAELRGAKKFSVSSCRARPRPGVSRPLERASGRLPLARSGPVWRSEAALDDLQGLPEPQHAKPGPR    561 - 630
KLAERGPQDSGDRAASPAGPRKSPQEAAAAPGTREPCPAAQEPAPSEDRNPFPVKLRSTSLSLKYRDGAS    631 - 700
QEVKGVKRYSAEVRLERSLTVLPKEEKCPLGTAPALRGTRAPSDQGKGKARPPEPLSSKPPLPRKPLLQS    701 - 770
FTLPHQPAPPDAGPGEREPRKEPRTAEKRPLRRGAEKSLPPAATGPGADGQPAPPWITVTRQKRRGTLDQ    771 - 840
PPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADFVRSKSFLITPVKPAVDRKQGAKLNFKEGLQRGIS    841 - 910
LSHQNLAQSAVMMEKELHQLKRASYASTDQPSWMELARKKSQAWSDMPQIIK                      911 - 962
//

Text Mined References (6)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.