Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.03
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.619 1.7e-07
intraductal papillary-mucinous adenoma (... 1.800 3.5e-05
intraductal papillary-mucinous carcinoma... 1.400 2.0e-03
lung carcinoma 1.200 2.0e-17
Pick disease 1.500 2.9e-05

Synonym

Accession A4D1U4 Q9ULS3
Symbols LCHN
PRO2561

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVEQGDAAPLLRWAEGPAVSLPQAPQPQAGGWGRGGGGGARPAAEPPRRREPEEPAAPEVLLQPGRLELG      1 - 70
DVEEDQVVAVFVVTFDPRSGNMVEWCLPQDIDLEGVEFKSMASGSHKIQSDFIYFRKGPFFGLACFANMP     71 - 140
VESELERGARMKSVGILSPSYTLLYRYMHFLENQVRHQLEMPGHYSHLAAFYEDKKGVLHAGPGRGSSLP    141 - 210
PVYWLPSIHRYMYPEMKITHPAGCMSQFIKFFGEQILILWKFALLRKRILIFSPPPVGVVCYRVYCCCCL    211 - 280
ANVSLPGIGGTIPESKPFFYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPL    281 - 350
LKINSADREKYRRLNEQRQMLLYSQEVEEDYNPCEEDLFVLFFLEQNNRIFQTLLEVSASQDKTLTAEHA    351 - 420
RGMGLDPQGDRSFLLDLLEAYGIDVMLVIDNPCCP                                       421 - 455
//

Text Mined References (5)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.