Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.8e-05
acute quadriplegic myopathy 1158 8.6e-05

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.194 8.6e-05
ovarian cancer -1.600 1.8e-05

AA Sequence

MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVE      1 - 70
EVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIK     71 - 140
NSSLLSFDNEDENE                                                            141 - 154
//

Text Mined References (17)

PMID Year Title