Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.29
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 1.7e-02
atypical teratoid / rhabdoid tumor -1.200 3.7e-05
cystic fibrosis 1.100 6.9e-04
ependymoma -1.800 2.1e-02
gastric carcinoma 1.400 1.5e-02
glioblastoma -1.100 5.3e-04
medulloblastoma, large-cell -1.200 4.4e-03
oligodendroglioma -1.200 3.3e-02
osteosarcoma -1.076 1.3e-02
ovarian cancer 2.600 4.3e-07
tuberculosis 1.300 6.4e-06
Waldenstrons macroglobulinemia 1.065 7.0e-03

Synonym

Accession Q6ICG6 B0QY17 B0QY19 B3KT48 Q6ZVE5 Q7Z6K9 Q8IZ76 Q9Y2E2
Symbols LSC3
C22orf9

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MLRAIAEERGRLSLRREVCGLGCFKDDRIVFWTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADG      1 - 70
RKAAEPEVEVEVYRRDSKKLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKKSQQV     71 - 140
FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVASDKTNTFQGVIFQGSIRYE    141 - 210
ALKKVYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVSTGDTSPCGTEEDSSPASP    211 - 280
MHERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSR    281 - 350
SLSGTGRSLVGSWLKLNRADGNFLLYAHLTYVTLPLHRILTDILEVRQKPILMT                    351 - 404
//

Text Mined References (17)

PMID Year Title