Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Diabetic Retinopathy 53
Disease Target Count P-value
ovarian cancer 8491 8.1e-06
Disease Target Count Z-score Confidence
Retinal disease 16 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 8.1e-06

Synonym

Accession Q8IV33 O94914 Q6ZNN2
Symbols C5orf36

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDIDEKIEQNAASIKHCIKEIQSEINKQCPGVQLQTTTD      1 - 70
CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDLSCHSSVSFPSTLSGTSFHF     71 - 140
LSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSKLQSHNEINNSQQKILLKKQCLQQLLFLYPESEVII    141 - 210
KYQNIQNKLLANLLWNCFPSYNRDSNLDVIAHGYQSTMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYL    211 - 280
DTVTEEMAKFLENFCELQFRENAVRVVKTSKSSSKHRGAVHALVTTECPQKGRNFSLPLDKVEFLSQLIK    281 - 350
SFMKLEKGVQELFDEILLSLKITRDTSGILEKSDREVVMEKPRANETNIPSEQSLPGKEATLLDFGWRSA    351 - 420
FKEVSLPMAHCVVTAIEGFSTKILQQEQNERSSAVSYAMNLVNVQQVWQDSHMFPEEEQPKKIGKFCSDI    421 - 490
MEKLDTMLPLALACRDDSFQEIRANLVEACCKVATAVLQRLQERAKEVPSKAPLKNLHTYLSTAVYVFQH    491 - 560
FKRYDNLMKEMTKKPIFLVLVQRYQEFINTLQFQVTNYCVRVCATSILQDAESHHWDDYKAFYEGERCSF    561 - 630
SIQMWHYFCWSLHYDLWTILPPKLAQEILVEVLEKSLSLLASRYARAHPSRKRTPQLRLDVTTILICTEN    631 - 700
MLWSVCTSVQKLLNPHQHTDDKIFKIHTHCNNLFTTLVILTSPLTELYKTFQHGLDESASDSLKSFFKQP    701 - 770
LYWVSCISHFYPSLLRTPSAGGLKAEGQLKLLLSQPRCNWNLLLETLLHHDGLLLRILLKSSKQVSDTEN    771 - 840
NLNQGPSLMEAIFKILYHCSFSPQTFANVFVSYMEEEQLWDFLYNIPVSTCVEYELEVIRCLRLALTDAI    841 - 910
KDTVQQIVSVMSSRRNCETNLNKHIVPDCLLESMPKEWNYSPKETNRKESCKSFTRLTAQAVSIVISKLP    911 - 980
TVIACLPPPVKYFFFLSERKMSKKFVELKKAGLLVWNLIVIICRIFEDGNTVELLTGASLDRWSKEKLGL    981 - 1050
ICMCLKSIMGDQTSIHNQMIQKVIQSIEQQKPNWIERQLLKARKLSTECAFMTIEKSTALQEGDVALELT   1051 - 1120
EQKINTMVLDLCHKPGGREYLRQIYHIMQLNEEYLKEQLFSMNSSEEKPLPIRPLKTTLRSIEDQPSAFN   1121 - 1190
PFHVYKAFSENMLDQVSITKWNWNWAKLLPNYLRLDKMTFSVLLKNRWEMKKDETLEEEEKAILEHLKQI   1191 - 1260
CTPQNSSASDNIEEQ                                                          1261 - 1275
//

Text Mined References (11)

PMID Year Title
27381092 2016 Estrogen-related receptor gamma implicated in a phenotype including hearing loss and mild developmental delay.
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
22318345 2012 A genome-wide association study identifies SNP in DCC is associated with gallbladder cancer in the Japanese population.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.