Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.19
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.500 4.4e-07
astrocytic glioma -1.800 3.5e-03
Astrocytoma, Pilocytic -2.300 2.6e-12
atypical teratoid / rhabdoid tumor -3.500 1.2e-14
colon cancer -1.300 6.6e-03
ependymoma -2.500 4.0e-03
glioblastoma -2.500 1.5e-12
group 3 medulloblastoma -2.400 1.2e-06
lung cancer -1.900 2.2e-05
malignant mesothelioma -1.800 2.9e-07
medulloblastoma, large-cell -3.400 2.2e-08
mucosa-associated lymphoid tissue lympho... 1.564 6.4e-03
oligodendroglioma -1.600 1.4e-02
osteosarcoma -1.011 3.4e-03
Pick disease -1.400 1.1e-02
pituitary cancer -1.800 5.3e-08
primitive neuroectodermal tumor -2.600 4.1e-06
subependymal giant cell astrocytoma -2.162 3.7e-02

Gene RIF (2)

AA Sequence

METPEVPVGSLIDFGPEAPTSSPLEAPPPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDR      1 - 70
RSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSSENGKGREWFARYV     71 - 140
SAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYYHIGKPQLLPPESREKPAGSID    141 - 210
SYLKSANSWLAEKKDIAERLLKNTSARTENVKGFFGGLETKLKGPLARRNEEDENKPQEKRPRAVTAYSP    211 - 280
EDEKKGEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDD    281 - 350
SLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQMATE             351 - 411
//

Text Mined References (13)

PMID Year Title