Property Summary

NCBI Gene PubMed Count 49
PubMed Score 48.23
PubTator Score 61.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.800 2.7e-08
astrocytic glioma -2.400 1.2e-03
Astrocytoma, Pilocytic -3.200 1.5e-14
atypical teratoid / rhabdoid tumor -2.900 4.7e-10
glioblastoma -2.700 1.6e-11
group 3 medulloblastoma -1.900 1.0e-04
lung carcinoma 1.100 1.3e-12
malignant mesothelioma 2.100 1.5e-07
medulloblastoma, large-cell -4.000 6.4e-09
oligodendroglioma -1.800 2.6e-02
primitive neuroectodermal tumor -2.400 2.1e-05

Gene RIF (43)

AA Sequence

MAPPTGVLSSLLLLVTIAGCARKQCSEGRTYSNAVISPNLETTRIMRVSHTFPVVDCTAACCDLSSCDLA      1 - 70
WWFEGRCYLVSCPHKENCEPKKMGPIRSYLTFVLRPVQRPAQLLDYGDMMLNRGSPSGIWGDSPEDIRKD     71 - 140
LTFLGKDWGLEEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVGDSPAVPAETQ    141 - 210
QDPELHYLNESASTPAPKLPERSVLLPLPTTPSSGEVLEKEKASQLQEQSSNSSGKEVLMPSHSLPPASL    211 - 280
ELSSVTVEKSPVLTVTPGSTEHSIPTPPTSAAPSESTPSELPISPTTAPRTVKELTVSAGDNLIITLPDN    281 - 350
EVELKAFVAPAPPVETTYNYEWNLISHPTDYQGEIKQGHKQTLNLSQLSVGLYVFKVTVSSENAFGEGFV    351 - 420
NVTVKPARRVNLPPVAVVSPQLQELTLPLTSALIDGSQSTDDTEIVSYHWEEINGPFIEEKTSVDSPVLR    421 - 490
LSNLDPGNYSFRLTVTDSDGATNSTTAALIVNNAVDYPPVANAGPNHTITLPQNSITLNGNQSSDDHQIV    491 - 560
LYEWSLGPGSEGKHVVMQGVQTPYLHLSAMQEGDYTFQLKVTDSSRQQSTAVVTVIVQPENNRPPVAVAG    561 - 630
PDKELIFPVESATLDGSSSSDDHGIVFYHWEHVRGPSAVEMENIDKAIATVTGLQVGTYHFRLTVKDQQG    631 - 700
LSSTSTLTVAVKKENNSPPRARAGGRHVLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGS    701 - 770
DHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQPDPRKSGLVELTLQVGVGQLTEQRKDTLVRQ    771 - 840
LAVLLNVLDSDIKVQKIRAHSDLSTVIVFYVQSRPPFKVLKAAEVARNLHMRLSKEKADFLLFKVLRVDT    841 - 910
AGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVTVLAFTLIVLTGGFTWLCICC    911 - 980
CKRQKRTKIRKKTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGN    981 - 1050
PKVSMNGSIRNGASFSYCSKDR                                                   1051 - 1072
//

Text Mined References (51)

PMID Year Title