Property Summary

NCBI Gene PubMed Count 10
PubMed Score 50.32
PubTator Score 10.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 6.3e-08
ovarian cancer 8491 4.8e-07
cystic fibrosis 1670 4.6e-04
subependymal giant cell astrocytoma 2287 1.6e-02
Disease Target Count Z-score Confidence
Congenital syphilis 4 3.124 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.050 6.3e-08
cystic fibrosis -1.100 4.6e-04
subependymal giant cell astrocytoma 1.453 1.6e-02
ovarian cancer -1.500 4.8e-07

Synonym

Accession Q14154 Q969R4 Q96EU9
Symbols DELE

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20563667 identifies a novel DAP3-binding protein termed death ligand signal enhancer (DELE); demonstrates the biological significance of DELE for apoptosis signal mediated by death receptors

AA Sequence

MWRLPGLLGRALPRTLGPSLWRVTPKSTSPDGPQTTSSTLLVPVPNLDRSGPHGPGTSGGPRSHGWKDAF      1 - 70
QWMSSRVSPNTLWDAISWGTLAVLALQLARQIHFQASLPAGPQRVEHCSWHSPLDRFFSSPLWHPCSSLR     71 - 140
QHILPSPDGPAPRHTGLREPRLGQEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKP    141 - 210
AQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSIAFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQ    211 - 280
YNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGL    281 - 350
REAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGN    351 - 420
EAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGAS    421 - 490
LEASSRAIPPHPYPLERSVVRLGFG                                                 491 - 515
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20563667 2010 Identification of DELE, a novel DAP3-binding protein which is crucial for death receptor-mediated apoptosis induction.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.