Property Summary

NCBI Gene PubMed Count 48
PubMed Score 84.42
PubTator Score 61.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
glioblastoma 5572 3.6e-07
ovarian cancer 8491 1.1e-06
psoriasis 6685 6.0e-06
atypical teratoid / rhabdoid tumor 4369 8.1e-06
medulloblastoma, large-cell 6234 4.4e-05
astrocytoma 1493 2.9e-04
osteosarcoma 7933 1.3e-02
Disease Target Count Z-score Confidence
Poliomyelitis 11 4.956 2.5

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -3.400 6.0e-06
osteosarcoma -1.511 1.3e-02
astrocytoma 2.200 2.9e-04
atypical teratoid / rhabdoid tumor 1.100 8.1e-06
glioblastoma 1.500 3.6e-07
medulloblastoma, large-cell 1.300 4.4e-05
ovarian cancer 2.000 1.1e-06

Gene RIF (28)

PMID Text
25993413 Khsrp as a highly regulated RBP in response to genotoxic stress.
25910425 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication.
24845017 The ability of KSRP to integrate different levels of gene expression is required for proper immune response. [Review]
24023901 subcellular localization of KSRP is regulated by competing interactions with DDX1 or 14-3-3
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of KH-type splicing regulatory protein (KHSRP, FUBP2) expression by HIV-1 Vpr in Vpr transduced macrophages
23524258 KSRP induces enhanced processing of pri- and pre-miR-155 in cystic fibrosis lung epithelial cells.
23345520 Enterovirus 71 infection cleaved FBP2, which altered its function when its carboxyl terminus was cleaved.
23142982 Binding of the human KSRP protein to let-7 miRNA precursors positively regulates their processing to mature let-7, thereby contributing to control of cell proliferation, apoptosis and differentiation
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of KH-type splicing regulatory protein (KHSRP, FUBP2) expression by HIV-1 Vpr in Vpr transduced macrophages
21935887 The role of KSRP in mRNA decay and microRNA precursor maturation.
21935400 RACK1 binds to KH-type splicing regulatory protein (KSRP), a member of the Dicer complex, and is required for the recruitment of mature miRNAs to the RNA-induced silencing complex (RISC).
21795706 KSRP-dependent silencing was reversed by IL-1, a strong inducer of IL-6 mRNA and protein expression.
21705779 KHSRP was identified as being involved in the regulation of rpL3 gene expression via alternative pre-mRNA splicing.
21627028 KSRP binds to the terminal loop sequence of a subset of miRNA precursors promoting their maturation (REVIEW)
21196264 In this review we will discuss in detail KSRP ability to i) promote decay of labile mRNAs interacting with some components of the mRNA decay machinery and ii) favor the maturation of a select group of microRNA precursors[review]
20639884 hnRNP A1 and KSRP have antagonistic roles in the post-transcriptional regulation of let-7a expression.
20332102 Dishevelled-KSRP complex operates in Wnt regulation of beta-catenin, functioning post-transcriptionally upon CTNNB1 mRNA stability.
19775426 Knock-down of either exosome components or KSRP by siRNAs prevents PMR1-mediated cleavage of PTH mRNA.
19585652 The coordinated activation of FBP-1 and FBP-2 represents a novel and frequent pro-tumorigenic mechanism promoting proliferation (tumor growth) and motility (dissemination) of human liver cancer cells.
19458619 KSRP serves as a component of both Drosha and Dicer complexes and regulates the biogenesis of a subset of miRNAs
19198587 The authors report that phosphorylation leads to the unfolding of the structurally atypical and unstable KH1, creating a site for 14-3-3zeta binding.
19003864 The over-expression of a novel protein family, far upstream binding proteins (FUBPs) was identified in both stages of hepatocellular carcinoma and confirmed by western blots.
18583400 These data indicate a novel role for KSRP in parathyroid hormone gene expression.
17908789 These results indicate that KSRP functions as a limiting factor in inflammatory gene expression.
16648466 KHSRP, tethered to mRNAs, elicits mRNA decay.
15514971 IL-8 RNA from IL-1beta-stimulated cytoplasmic extract revealed a 20-fold greater association of transcript with the stabilizing factor HuR vs. the destabilizing factor KSRP in breast cancer cells
15175153 KSRP, a KH domain-containing ARE-BP, is an essential factor for ARE-directed mRNA decay. Some KH motifs of KSRP mediate RNA binding, mRNA decay, and interactions with the exosome.
14657238 KSRP do indeed interact with the c-src transcript in vivo, and that these associations change with the differentiated state of the cell.

AA Sequence

MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIR      1 - 70
KDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPP     71 - 140
PRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDD    141 - 210
IVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVD    211 - 280
KPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQN    281 - 350
DAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW    351 - 420
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQL    421 - 490
IEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPH    491 - 560
DPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIG    561 - 630
QQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQP    631 - 700
PPTQQGQQQAQ                                                               701 - 711
//

Text Mined References (67)

PMID Year Title
25993413 2015 Label-Free Protein-RNA Interactome Analysis Identifies Khsrp Signaling Downstream of the p38/Mk2 Kinase Complex as a Critical Modulator of Cell Cycle Progression.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25910425 2015 Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24845017 2014 KSRP controls pleiotropic cellular functions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24023901 2013 DEAD box protein DDX1 regulates cytoplasmic localization of KSRP.
23524258 2013 Regulation of miR-155 biogenesis in cystic fibrosis lung epithelial cells: antagonistic role of two mRNA-destabilizing proteins, KSRP and TTP.
23345520 2013 Enterovirus 71 infection cleaves a negative regulator for viral internal ribosomal entry site-driven translation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142982 2012 Noncanonical G recognition mediates KSRP regulation of let-7 biogenesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21935887 The role of KSRP in mRNA decay and microRNA precursor maturation.
21935400 2011 Receptor for activated protein kinase C: requirement for efficient microRNA function and reduced expression in hepatocellular carcinoma.
21795706 2011 Interleukin-1 activates synthesis of interleukin-6 by interfering with a KH-type splicing regulatory protein (KSRP)-dependent translational silencing mechanism.
21705779 2011 Autoregulatory circuit of human rpL3 expression requires hnRNP H1, NPM and KHSRP.
21627028 2010 KSRP promotes the maturation of a group of miRNA precursors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21196264 2011 KSRP, many functions for a single protein.
20639884 2010 Antagonistic role of hnRNP A1 and KSRP in the regulation of let-7a biogenesis.
20562859 2010 Network organization of the human autophagy system.
20332102 2010 Dishevelled-KSRP complex regulates Wnt signaling through post-transcriptional stabilization of beta-catenin mRNA.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19775426 2009 KSRP-PMR1-exosome association determines parathyroid hormone mRNA levels and stability in transfected cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19585652 2009 Overexpression of far upstream element binding proteins: a mechanism regulating proliferation and migration in liver cancer cells.
19458619 2009 The RNA-binding protein KSRP promotes the biogenesis of a subset of microRNAs.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19198587 2009 Phosphorylation-mediated unfolding of a KH domain regulates KSRP localization via 14-3-3 binding.
19003864 2008 2-D DIGE profiling of hepatocellular carcinoma tissues identified isoforms of far upstream binding protein (FUBP) as novel candidates in liver carcinogenesis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18583400 2008 The mRNA decay promoting factor K-homology splicing regulator protein post-transcriptionally determines parathyroid hormone mRNA levels.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17908789 2007 Functional analysis of KSRP interaction with the AU-rich element of interleukin-8 and identification of inflammatory mRNA targets.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17437720 2007 The structure of the C-terminal KH domains of KSRP reveals a noncanonical motif important for mRNA degradation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16648466 2006 Tethering KSRP, a decay-promoting AU-rich element-binding protein, to mRNAs elicits mRNA decay.
16126846 2005 Involvement of KSRP in the post-transcriptional regulation of human iNOS expression-complex interplay of KSRP with TTP and HuR.
15606899 2005 Beta-amyloid protein converting enzyme 1 and brain-specific type II membrane protein BRI3: binding partners processed by furin.
15514971 2005 IL-1beta induces stabilization of IL-8 mRNA in malignant breast cancer cells via the 3' untranslated region: Involvement of divergent RNA-binding factors HuR, KSRP and TIAR.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175153 2004 A KH domain RNA binding protein, KSRP, promotes ARE-directed mRNA turnover by recruiting the degradation machinery.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14657238 2004 Differentiation-induced colocalization of the KH-type splicing regulatory protein with polypyrimidine tract binding protein and the c-src pre-mRNA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
11003644 2000 Cooperative assembly of an hnRNP complex induced by a tissue-specific homolog of polypyrimidine tract binding protein.
10911989 2000 Multisite RNA binding and release of polypyrimidine tract binding protein during the regulation of c-src neural-specific splicing.
10781591 2000 Purification and molecular cloning of a novel essential component of the apolipoprotein B mRNA editing enzyme-complex.
10087204 1999 Mapping of the KHSRP gene to a region of conserved synteny on human chromosome 19p13.3 and mouse chromosome 17.
9858532 1999 hnRNP H is a component of a splicing enhancer complex that activates a c-src alternative exon in neuronal cells.
9136930 1997 A new regulatory protein, KSRP, mediates exon inclusion through an intronic splicing enhancer.
8940189 1996 The far upstream element-binding proteins comprise an ancient family of single-strand DNA-binding transactivators.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.