Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.18
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 4.4e-04
glioblastoma 1.300 9.9e-06
intraductal papillary-mucinous adenoma (... 1.100 5.0e-04
lung cancer -3.100 6.2e-04
osteosarcoma -1.429 1.4e-04
ovarian cancer 1.800 2.5e-04
tuberculosis -1.100 5.4e-06

 GO Function (1)

Gene RIF (1)

AA Sequence

MPTWGARPASPDRFAVSAEAENKVREQQPHVERIFSVGVSVLPKDCPDNPHIWLQLEGPKENASRAKEYL      1 - 70
KGLCSPELQDEIHYPPKLHCIFLGAQGFFLDCLAWSTSAHLVPRAPGSLMISGLTEAFVMAQSRVEELAE     71 - 140
RLSWDFTPGPSSGASQCTGVLRDFSALLQSPGDAHREALLQLPLAVQEELLSLVQEASSGQGPGALASWE    141 - 210
GRSSALLGAQCQGVRAPPSDGRESLDTGSMGPGDCRGARGDTYAVEKEGGKQGGPREMDWGWKELPGEEA    211 - 280
WEREVALRPQSVGGGARESAPLKGKALGKEEIALGGGGFCVHREPPGAHGSCHRAAQSRGASLLQRLHNG    281 - 350
NASPPRVPSPPPAPEPPWHCGDRGDCGDRGDVGDRGDKQQGMARGRGPQWKRGARGGNLVTGTQRFKEAL    351 - 420
QDPFTLCLANVPGQPDLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVFVPQWRFSKDA    421 - 490
KVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIVSNDQFRDLAEESEKWMAIIR    491 - 560
ERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGSSKAQHPSRGFAEHGKQQQGREEEKGSGGIR    561 - 630
KTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDINQLSEALLSLNF                          631 - 678
//

Text Mined References (13)

PMID Year Title