Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.18
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 4.4e-04
glioblastoma 1.300 9.9e-06
intraductal papillary-mucinous adenoma (... 1.100 5.0e-04
lung cancer -3.100 6.2e-04
osteosarcoma -1.429 1.4e-04
ovarian cancer 1.800 2.5e-04
tuberculosis -1.100 5.4e-06

Synonym

Accession O15037 Q86TZ6 Q8IUQ2 Q96BA9
Symbols KIAA0323

Gene

PANTHER Protein Class (1)

PDB

2N5M   2N7K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (1)

AA Sequence

MPTWGARPASPDRFAVSAEAENKVREQQPHVERIFSVGVSVLPKDCPDNPHIWLQLEGPKENASRAKEYL      1 - 70
KGLCSPELQDEIHYPPKLHCIFLGAQGFFLDCLAWSTSAHLVPRAPGSLMISGLTEAFVMAQSRVEELAE     71 - 140
RLSWDFTPGPSSGASQCTGVLRDFSALLQSPGDAHREALLQLPLAVQEELLSLVQEASSGQGPGALASWE    141 - 210
GRSSALLGAQCQGVRAPPSDGRESLDTGSMGPGDCRGARGDTYAVEKEGGKQGGPREMDWGWKELPGEEA    211 - 280
WEREVALRPQSVGGGARESAPLKGKALGKEEIALGGGGFCVHREPPGAHGSCHRAAQSRGASLLQRLHNG    281 - 350
NASPPRVPSPPPAPEPPWHCGDRGDCGDRGDVGDRGDKQQGMARGRGPQWKRGARGGNLVTGTQRFKEAL    351 - 420
QDPFTLCLANVPGQPDLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVFVPQWRFSKDA    421 - 490
KVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIVSNDQFRDLAEESEKWMAIIR    491 - 560
ERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGSSKAQHPSRGFAEHGKQQQGREEEKGSGGIR    561 - 630
KTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDINQLSEALLSLNF                          631 - 678
//

Text Mined References (13)

PMID Year Title