Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.10
PubTator Score 7.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Melanoma 689 0.0 0.5
Disease Target Count P-value
non-small cell lung carcinoma 302 8.9e-25
lung carcinoma 2755 4.5e-23
lung adenocarcinoma 2627 3.8e-16
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Skin cancer 451 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 1.2
Disease Target Count Z-score Confidence
Retinitis pigmentosa 25 9 4.954 2.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -2.100 3.8e-16
lung carcinoma -2.700 4.5e-23
non-small cell lung carcinoma -1.900 8.9e-25

Gene RIF (3)

AA Sequence

MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ      1 - 70
YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAP     71 - 140
PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI    141 - 210
PPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEY    211 - 280
DDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY     281 - 349
//

Text Mined References (19)

PMID Year Title