Property Summary

NCBI Gene PubMed Count 22
PubMed Score 46.21
PubTator Score 12.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.410 9.7e-03

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26792738 These results suggest that direct interaction of JMJD5 with HBx facilitates hepatitis B virus replication through the hydroxylase activity of JMJD5.
26710852 Data suggest that JMJD5 partially accumulates on mitotic spindles during mitosis; depletion of JMJD5 results in significant mitotic arrest, spindle assembly defects, and sustained activation of spindle assembly checkpoint.
26261525 Suggest JMJD5 as a potential oncogene in colon carcinogenesis.
26025680 results reveal that JMJD5 is a novel binding partner of p53 and it functions as a positive modulator of cell cycle and cell proliferation mainly through the repression of p53 pathway.
24981860 RCCD1 and KDM8 form a histone demethylase complex.
24740926 we provide genetic and biochemical evidence that the JMJD5/CDKN1A (p21) axis is essential to maintaining the short G1 phase which is critical for pluripotency in human embryonic stem cells
24344305 JMJD5 has a role in regulating PKM2 nuclear translocation and reprogramming HIF-1alpha-mediated glucose metabolism
24100311 Comparison of the structure of JMJD5 with that of FIH, a well characterized protein hydroxylase, reveals that human JMJD5 might function as a protein hydroxylase.
23948433 These results reveal that the N-terminal domain is essential for the nuclear localization of JMJD5 and its normal enzymatic function towards substrates in the nucleus
22851697 The study reports high-resolution crystal structures of the human JMJD5 catalytic domain in complex with the substrate 2-oxoglutarate (2-OG) and the inhibitor N-oxalylglycine (NOG).
22375008 JMJD5 is a post-translational co-repressor for NFATc1 that attenuates osteoclastogenesis.
21115819 Data show that both Arabidopsis jmjd5 mutant seedlings and mammalian cell cultures deficient for the human ortholog of this gene have similar fast-running circadian oscillations compared with WT.
20457893 show that JMJD5 (now renamed KDM8), demethylates H3K36me2 and is required for cell cycle progression.
16858412 Identifies five novel candidate tumor suppressor genes in mouse, including Pou2f2, Hivep3, Jmjd5, Fbxl10 and a protein similar to human N4BP3.

AA Sequence

MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV      1 - 70
ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK     71 - 140
VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG    141 - 210
VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD    211 - 280
QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY    281 - 350
PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS        351 - 416
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26792738 2016 Hepatocyte Factor JMJD5 Regulates Hepatitis B Virus Replication through Interaction with HBx.
26710852 2016 JMJD5 (Jumonji Domain-containing 5) Associates with Spindle Microtubules and Is Required for Proper Mitosis.
26261525 2015 JMJD5 is a potential oncogene for colon carcinogenesis.
26025680 2015 JMJD5 interacts with p53 and negatively regulates p53 function in control of cell cycle and proliferation.
24981860 2014 Human-chromatin-related protein interactions identify a demethylase complex required for chromosome segregation.
24740926 2014 JMJD5 regulates cell cycle and pluripotency in human embryonic stem cells.
24344305 2014 JMJD5 regulates PKM2 nuclear translocation and reprograms HIF-1?-mediated glucose metabolism.
24100311 2013 Structure of the JmjC-domain-containing protein JMJD5.
23948433 2013 Identification and functional implication of nuclear localization signals in the N-terminal domain of JMJD5.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22851697 2012 Crystal structure and functional analysis of JMJD5 indicate an alternate specificity and function.
22375008 2012 JMJD5, a Jumonji C (JmjC) domain-containing protein, negatively regulates osteoclastogenesis by facilitating NFATc1 protein degradation.
21115819 2010 Jumonji domain protein JMJD5 functions in both the plant and human circadian systems.
20457893 2010 KDM8, a H3K36me2 histone demethylase that acts in the cyclin A1 coding region to regulate cancer cell proliferation.
17909537 2007 Histone lysine demethylases: emerging roles in development, physiology and disease.
16858412 2006 Tumor suppressor gene identification using retroviral insertional mutagenesis in Blm-deficient mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.