Property Summary

NCBI Gene PubMed Count 51
PubMed Score 144.66
PubTator Score 68.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.200 9.6e-06
ependymoma 1.100 2.7e-03
psoriasis -3.900 4.5e-06
osteosarcoma -1.981 1.9e-07
medulloblastoma 1.500 9.3e-04
atypical teratoid / rhabdoid tumor 1.300 7.6e-05
glioblastoma 1.200 4.8e-05
medulloblastoma, large-cell 1.700 2.9e-04
primitive neuroectodermal tumor 1.500 2.5e-05
tuberculosis -1.800 9.7e-05
non-small cell lung cancer -1.583 3.2e-13
lung cancer -2.000 1.6e-04

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (46)

PMID Text
26871869 JMJD3 and EZH2 in prostate biopsies also demonstrated an increase of JMJD3 and EZH2 in adenocarcinoma with Gleason score 7 and 8 by comparison with a normal biopsy.
26802933 JMJD3 up-regulation and NF-kappaB activation occur in the region of the wound edge during keratinocyte wound healing
26795455 Jmjd3 regulates osteoblast apoptosis through targeting Bcl-2 expression and Bim phosphorylation.
26729791 Findings reveal a novel epigenetic mechanism by which JMJD3 promotes melanoma progression and metastasis.
26416711 Low JMJD3 expression is associated with Colorectal Cancer.
26303949 KDM6B may act in a pro-apoptotic role in NSCLC.
26261509 We demonstrate that KDM6B plays a key role in clear cell renal cell carcinoma
26193001 JMJD3 is an epigenetic regulator in development and disease. (Review)
25827480 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25791244 Data indicate a reverse correlation between the mRNA levels of histone H3 lysine-27 demethylase (JMJD3) and global histone h3 lysine 27 methylation (H3K27me3).
25698448 JMJD3 promotes SAHF formation by demethylating RB at K810, which reduce the level of phosphorylation of RB protein at S807/811, and this interplay promotes the formation of senescence-associated heterochromatin foci in senescent WI38 cells.
25652587 Results show that JMJD3 protein is overexpressed in high-grade glioma cells and correlated with dysfunctional activation of senescence-related processes, including proinflammatory cytokines and stem cell tropism toward tumors.
25520177 KDM6B is a new hypoxia response gene regulated by HIF-2alpha
25049231 demonstrated that miR-941 and KDM6B regulated the epithelial-mesenchymal transition process and affected cell migratory/invasive properties
24947179 our results propose a significant role for the KDM6B-C/EBPalpha axis in the pancreatic ductal adenocarcinoma phenotype.
24925089 JMJD3 at the nexus of epigenetic regulation of inflammation and the aging process
24797517 JMJD3 is recruited to p53 responsive elements via its interaction with p53 and therefore could act as a fail-safe mechanism to remove low levels of H3K27me3 and H3K27me2 to allow for efficient acetylation of H3K27.
24726732 JMJD3 promotes osteogenesis in differentiating human mesenchymal stem cells, with MIR146A regulating JMJD3.
24646476 Subcellular localization of Jmjd3 is dynamically regulated and has pivotal roles for H3K27me3 status.
24572572 Histone demethylase Jmjd3 is required for the development of subsets of retinal bipolar cells.
24212761 Studies indicate that Jmjd3 is able to enhance the polarization of M2 microglia by modifying histone H3K27me3, and it has a pivotal role in the switch of microglia phenotypes that may contribute to the immune pathogenesis of PD.
24162774 HIV-1 gp120 upregulates the expression of lysine-specific demethylase 6B (KDM6B) in human B cells
24158144 results demonstrated critical role of histone demethylase in epigenetic regulation of odontogenic differentiation of dental MSCs. KDM6B may present potential therapeutic target in regeneration of tooth structures and repair of craniofacial defects.
23711388 Data suggest that the suppression of different key inflammatory regulators through JMJD3-attenuation would evaluate potential therapeutic targets and to elucidate the molecular mechanism of JMJD3-knockdown (KD) dependent effects in THP-1 cells.
23538751 Overexpression of JMJD3 is associated with myelodysplastic syndrome.
23236496 Deregulation of JMJD3 may contribute to gliomagenesis via inhibition of the p53 pathway resulting in a block to terminal differentiation.
23152497 Overexpression of KDM6B induced the expression of mesenchymal genes and promoted epithelial-mesenchymal transition.
22955275 ATF4-dependent regulation of the JMJD3 gene during amino acid deprivation can be rescued in Atf4-deficient cells by inhibition of deacetylation.
22915621 These data demonstrate a novel role of H3 Lys27 histone methylation in fibrosis in systemic sclerosis.
22907667 KDM6B contributes to the activation of WNT3 and DKK1 at different differentiation stages when WNT3 and DKK1 are required for mesendoderm and definitive endoderm differentiation.
22782721 neurogenesis is promoted by an interplay between the TGFbeta pathway, Smad3, and the H3K27me3 histone demethylase (HDM) JMJD3
22770241 The histone demethylases KDM4B and KDM6B play critical roles in osteogenic commitment of mesenchymal stem/stromal cells.
22713873 JMJD3 activates bivalent gene transcription by demethylating H3K27me3 and promoting transcriptional elongation.
22589717 PAN RNA interacts with demethylases JMJD3 and UTX, and the histone methyltransferase MLL2
22252741 Knockdown of JMJD3 in THP-1 cells affected expression of key genes in NF-kappaB, chemokine and CD40 signalling.
22020331 loss of BTG3 in normal cells induced cellular senescence, which was correlated with enhanced ERK-AP1 signaling and elevated expression of the histone H3K27me3 demethylase JMJD3/KDM6B
21890490 An epigenetic gene coding for a histone demethylase such as JMJD3 is a VDR co-target that partially mediates the effects of 1,25(OH)(2)D(3) on human colon.
21841772 H3K27 demethylation by JMJD3 at a poised enhancer of anti-apoptotic gene BCL2 determines ERalpha ligand dependency
21245294 KDM6A- and KDM6B-responsive Homeobox genes are expressed at significantly higher levels, suggesting that HPV16 E7 results in reprogramming of host epithelial cells
21242977 KDM6B may have a role in antigen-driven B-cell differentiation.
21209387 The role of the H3K27 demethylases Jmjd3 and UTX in gene expression, is discussed.
19451217 JMJD3 expression is induced upon activation of the RAS-RAF signaling pathway
18628393 These results indicate that epigenetic derepression by JMJD3 controls mammalian epidermal differentiation.
18003914 JMJD3 demethylates di- and trimethylated lysine 27 of histone H3 in vitro and in cells.
17923864 JMJD3 was identified as a demethylase capable of removing the trimethyl group from histone H3 lysine 27 and upregulated in prostate cancer.
17713478 the human JmjC-domain-containing proteins UTX and JMJD3 demethylate tri-methylated Lys 27 on histone H3

AA Sequence

MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLPAPLPPSHGSSSGH      1 - 70
PSKPYYAPGAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEATRCYHSALRYGGSF     71 - 140
AELGPRIGRLQQAQLWNFHTGSCQHRAKVLPPLEQVWNLLHLEHKRNYGAKRGGPPVKRAAEPPVVQPVP    141 - 210
PAALSGPSGEEGLSPGGKRRRGCNSEQTGLPPGLPLPPPPLPPPPPPPPPPPPPLPGLATSPPFQLTKPG    211 - 280
LWSTLHGDAWGPERKGSAPPERQEQRHSLPHPYPYPAPAYTAHPPGHRLVPAAPPGPGPRPPGAESHGCL    281 - 350
PATRPPGSDLRESRVQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTSSSSSSSSNTGLRGVEPNPGIP    351 - 420
GADHYQTPALEVSHHGRLGPSAHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPPPPPAWLKGPA    421 - 490
CRAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDSHTPPTPPTPTTSSSNSNSGS    491 - 560
HSSSPAGPVSFPPPPYLARSIDPLPRPPSPAQNPQDPPLVPLTLALPPAPPSSCHQNTSGSFRRPESPRP    561 - 630
RVSFPKTPEVGPGPPPGPLSKAPQPVPPGVGELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMK    631 - 700
MLDESIRKEEEQQQHEAGVAPQPPLKEPFASLQSPFPTDTAPTTTAPAVAVTTTTTTTTTTTATQEEEKK    701 - 770
PPPALPPPPPLAKFPPPSQPQPPPPPPPSPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPG    771 - 840
PPSGATALPPTSAAPSAQGSPQPSASSSSQFSTSGGPWARERRAGEEPVPGPMTPTQPPPPLSLPPARSE    841 - 910
SEVLEEISRACETLVERVGRSATDPADPVDTAEPADSGTERLLPPAQAKEEAGGVAAVSGSCKRRQKEHQ    911 - 980
KEHRRHRRACKDSVGRRPREGRAKAKAKVPKEKSRRVLGNLDLQSEEIQGREKSRPDLGGASKAKPPTAP    981 - 1050
APPSAPAPSAQPTPPSASVPGKKAREEAPGPPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIA   1051 - 1120
SEVEERRLRMADLTISHCAADVVRASRNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYL   1121 - 1190
ESKRDAFSPVLLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLT   1191 - 1260
GTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEEKESEDEESEEPDSTTGTPPSSAPDPKNHHIIKFGT   1261 - 1330
NIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVN   1331 - 1400
INIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPILDDLYASNIPVYRFVQRPGDLVWINAGTVH   1401 - 1470
WVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCL   1471 - 1540
LQSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRS   1541 - 1610
AGLQGVVVLEQYRTEELAQAYDAFTLAPASTSR                                        1611 - 1643
//

Text Mined References (57)

PMID Year Title
26871869 2016 The JMJD3 Histone Demethylase and the EZH2 Histone Methyltransferase in Prostate Cancer.
26802933 2016 Histone H3K27 Demethylase JMJD3 in Cooperation with NF-?B Regulates Keratinocyte Wound Healing.
26795455 2016 Histone demethylase Jmjd3 regulates osteoblast apoptosis through targeting anti-apoptotic protein Bcl-2 and pro-apoptotic protein Bim.
26729791 2016 H3K27 Demethylase JMJD3 Employs the NF-?B and BMP Signaling Pathways to Modulate the Tumor Microenvironment and Promote Melanoma Progression and Metastasis.
26416711 2016 The Prognostic Significance of Histone Lysine Demethylase JMJD3/KDM6B in Colorectal Cancer.
26303949 2015 KDM6B Elicits Cell Apoptosis by Promoting Nuclear Translocation of FOXO1 in Non-Small Cell Lung Cancer.
26261509 2015 KDM6B induces epithelial-mesenchymal transition and enhances clear cell renal cell carcinoma metastasis through the activation of SLUG.
26193001 2015 JMJD3 as an epigenetic regulator in development and disease.
25827480 2015 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25791244 2015 Overexpression of JMJD3 may contribute to demethylation of H3K27me3 in CD4+ T cells from patients with systemic sclerosis.
25698448 2015 JMJD3 promotes SAHF formation in senescent WI38 cells by triggering an interplay between demethylation and phosphorylation of RB protein.
25652587 2015 The histone demethylase jumonji coordinates cellular senescence including secretion of neural stem cell-attracting cytokines.
25520177 2015 Regulation of histone demethylase KDM6B by hypoxia-inducible factor-2?.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25049231 2014 DNA methylation-mediated repression of miR-941 enhances lysine (K)-specific demethylase 6B expression in hepatoma cells.
24947179 2014 Loss of histone demethylase KDM6B enhances aggressiveness of pancreatic cancer through downregulation of C/EBP?.
24925089 2014 Histone demethylase Jumonji D3 (JMJD3/KDM6B) at the nexus of epigenetic regulation of inflammation and the aging process.
24797517 2014 The histone lysine demethylase JMJD3/KDM6B is recruited to p53 bound promoters and enhancer elements in a p53 dependent manner.
24726732 2014 MIR146A inhibits JMJD3 expression and osteogenic differentiation in human mesenchymal stem cells.
24646476 2014 The localization of histone H3K27me3 demethylase Jmjd3 is dynamically regulated.
24572572 2014 Histone demethylase Jmjd3 is required for the development of subsets of retinal bipolar cells.
24212761 2014 Jmjd3 is essential for the epigenetic modulation of microglia phenotypes in the immune pathogenesis of Parkinson's disease.
24158144 2013 KDM6B epigenetically regulates odontogenic differentiation of dental mesenchymal stem cells.
23856522 2013 Jmjd3 controls mesodermal and cardiovascular differentiation of embryonic stem cells.
23711388 2013 Proteomic changes induced by histone demethylase JMJD3 in TNF alpha-treated human monocytic (THP-1) cells.
23538751 2013 Global H3K4me3 genome mapping reveals alterations of innate immunity signaling and overexpression of JMJD3 in human myelodysplastic syndrome CD34+ cells.
23236496 2012 Histone demethylase Jumonji D3 (JMJD3) as a tumor suppressor by regulating p53 protein nuclear stabilization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152497 2012 Histone demethylase KDM6B promotes epithelial-mesenchymal transition.
22955275 2012 ATF4-dependent regulation of the JMJD3 gene during amino acid deprivation can be rescued in Atf4-deficient cells by inhibition of deacetylation.
22915621 2013 Inhibition of H3K27 histone trimethylation activates fibroblasts and induces fibrosis.
22907667 2013 Histone H3K27me3 demethylases KDM6A and KDM6B modulate definitive endoderm differentiation from human ESCs by regulating WNT signaling pathway.
22782721 2012 Genome-wide analysis reveals that Smad3 and JMJD3 HDM co-activate the neural developmental program.
22770241 2012 Histone demethylases KDM4B and KDM6B promotes osteogenic differentiation of human MSCs.
22713873 2012 The histone H3 Lys 27 demethylase JMJD3 regulates gene expression by impacting transcriptional elongation.
22589717 2012 KSHV PAN RNA associates with demethylases UTX and JMJD3 to activate lytic replication through a physical interaction with the virus genome.
22252741 2012 Gene networking and inflammatory pathway analysis in a JMJD3 knockdown human monocytic cell line.
22020331 2012 Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.
21890490 2011 KDM6B/JMJD3 histone demethylase is induced by vitamin D and modulates its effects in colon cancer cells.
21841772 2011 H3K27 demethylation by JMJD3 at a poised enhancer of anti-apoptotic gene BCL2 determines ER? ligand dependency.
21245294 2011 Human papillomavirus E7 oncoprotein induces KDM6A and KDM6B histone demethylase expression and causes epigenetic reprogramming.
21242977 2011 The H3K27me3 demethylase, KDM6B, is induced by Epstein-Barr virus and over-expressed in Hodgkin's Lymphoma.
21209387 2010 Role of H3K27 demethylases Jmjd3 and UTX in transcriptional regulation.
19451217 2009 The H3K27me3 demethylase JMJD3 contributes to the activation of the INK4A-ARF locus in response to oncogene- and stress-induced senescence.
18628393 2008 Control of differentiation in a self-renewing mammalian tissue by the histone demethylase JMJD3.
18003914 2007 Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.
17923864 2007 JMJD3 is a histone H3K27 demethylase.
17851529 2007 A histone H3 lysine 27 demethylase regulates animal posterior development.
17825402 2007 The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing.
17713478 2007 UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.
17193924 2006 An efficient strategy to identify early TPA-responsive genes during differentiation of HL-60 cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.